BLASTX nr result
ID: Jatropha_contig00039567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039567 (284 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncat... 81 9e-17 >ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncatula] gi|355477374|gb|AES58577.1| ATP synthase subunit alpha [Medicago truncatula] Length = 1116 Score = 81.3 bits (199), Expect(2) = 9e-17 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -1 Query: 281 FFFFVSEPFWRGVLNPLRTTPPGGSPECRVFLRRQLDVVVTCK 153 F F S FWRGVLNPLRTTPPGGSPECRVFLRRQLDVV+TCK Sbjct: 703 FCLFRSRLFWRGVLNPLRTTPPGGSPECRVFLRRQLDVVLTCK 745 Score = 30.8 bits (68), Expect(2) = 9e-17 Identities = 18/21 (85%), Positives = 18/21 (85%), Gaps = 2/21 (9%) Frame = -3 Query: 57 RTLESAS--KGAGSPLTDSTA 1 RTLESAS KGAGS LTDSTA Sbjct: 773 RTLESASNSKGAGSLLTDSTA 793