BLASTX nr result
ID: Jatropha_contig00039566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039566 (588 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514684.1| diacylglycerol kinase, theta, putative [Rici... 64 3e-08 >ref|XP_002514684.1| diacylglycerol kinase, theta, putative [Ricinus communis] gi|223546288|gb|EEF47790.1| diacylglycerol kinase, theta, putative [Ricinus communis] Length = 724 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 469 MDDDREIEMLLPGWNNPIESRIFIFSCFLAALM 567 MDDD EI+MLLPGWNNP ESRIFIFSCF+AAL+ Sbjct: 1 MDDDIEIQMLLPGWNNPTESRIFIFSCFIAALV 33