BLASTX nr result
ID: Jatropha_contig00039544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039544 (243 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516275.1| protein binding protein, putative [Ricinus c... 74 2e-11 gb|EOY30256.1| Tubulin-tyrosine ligases,tubulin-tyrosine ligases... 70 4e-10 gb|EOY30254.1| Tubulin-tyrosine ligases,tubulin-tyrosine ligases... 70 4e-10 gb|ESR66043.1| hypothetical protein CICLE_v10007418mg [Citrus cl... 68 1e-09 ref|XP_002326123.1| predicted protein [Populus trichocarpa] gi|5... 64 2e-08 gb|EMJ05486.1| hypothetical protein PRUPE_ppa001302mg [Prunus pe... 62 1e-07 ref|XP_004488089.1| PREDICTED: tubulin--tyrosine ligase-like pro... 60 3e-07 ref|XP_004488088.1| PREDICTED: tubulin--tyrosine ligase-like pro... 60 3e-07 ref|XP_004161112.1| PREDICTED: LOW QUALITY PROTEIN: tubulin--tyr... 59 8e-07 ref|XP_004144031.1| PREDICTED: tubulin--tyrosine ligase-like pro... 59 8e-07 ref|XP_004288983.1| PREDICTED: tubulin--tyrosine ligase-like pro... 57 2e-06 gb|ESQ33251.1| hypothetical protein EUTSA_v10003638mg [Eutrema s... 56 4e-06 ref|XP_002889147.1| predicted protein [Arabidopsis lyrata subsp.... 55 9e-06 >ref|XP_002516275.1| protein binding protein, putative [Ricinus communis] gi|223544761|gb|EEF46277.1| protein binding protein, putative [Ricinus communis] Length = 851 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = +1 Query: 115 MSTTVSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSK 240 M+ TV+RIETY+DFVK HG+LLAASGLP+SLHYKLFEKLTS+ Sbjct: 1 MTATVARIETYDDFVKVHGLLLAASGLPQSLHYKLFEKLTSE 42 >gb|EOY30256.1| Tubulin-tyrosine ligases,tubulin-tyrosine ligases isoform 3 [Theobroma cacao] Length = 772 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 118 STTVSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 ++T RIETYEDFVK HG+LLAASGLP+SLH KLFEKLTS+T Sbjct: 6 ASTCGRIETYEDFVKVHGLLLAASGLPQSLHRKLFEKLTSET 47 >gb|EOY30254.1| Tubulin-tyrosine ligases,tubulin-tyrosine ligases isoform 1 [Theobroma cacao] gi|508782999|gb|EOY30255.1| Tubulin-tyrosine ligases,tubulin-tyrosine ligases isoform 1 [Theobroma cacao] Length = 869 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 118 STTVSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 ++T RIETYEDFVK HG+LLAASGLP+SLH KLFEKLTS+T Sbjct: 6 ASTCGRIETYEDFVKVHGLLLAASGLPQSLHRKLFEKLTSET 47 >gb|ESR66043.1| hypothetical protein CICLE_v10007418mg [Citrus clementina] Length = 871 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +1 Query: 115 MSTTVSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 MS+ +RIETYEDFVK HGVLLAASGLP+SLH +LF+KLT++T Sbjct: 1 MSSNSNRIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTET 43 >ref|XP_002326123.1| predicted protein [Populus trichocarpa] gi|550336331|gb|ERP59420.1| tubulin-tyrosine ligase family protein [Populus trichocarpa] Length = 868 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = +1 Query: 127 VSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 +++I+ YEDFVK HG+LLAASGLPR+LH KLF+KLTS+T Sbjct: 1 MTKIQAYEDFVKVHGILLAASGLPRTLHRKLFDKLTSET 39 >gb|EMJ05486.1| hypothetical protein PRUPE_ppa001302mg [Prunus persica] Length = 859 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = +1 Query: 127 VSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 ++RIETYEDFVK HG+LLAASGLP+SLH +LF+KL S++ Sbjct: 1 MTRIETYEDFVKVHGLLLAASGLPQSLHRQLFQKLLSES 39 >ref|XP_004488089.1| PREDICTED: tubulin--tyrosine ligase-like protein 12-like isoform X2 [Cicer arietinum] Length = 874 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +1 Query: 124 TVSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 T +RI+TY+DF K HG+LLAASGLP SLH +LF+KL ++T Sbjct: 6 TTNRIQTYQDFAKVHGILLAASGLPESLHRRLFQKLFTET 45 >ref|XP_004488088.1| PREDICTED: tubulin--tyrosine ligase-like protein 12-like isoform X1 [Cicer arietinum] Length = 876 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +1 Query: 124 TVSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 T +RI+TY+DF K HG+LLAASGLP SLH +LF+KL ++T Sbjct: 6 TTNRIQTYQDFAKVHGILLAASGLPESLHRRLFQKLFTET 45 >ref|XP_004161112.1| PREDICTED: LOW QUALITY PROTEIN: tubulin--tyrosine ligase-like protein 12-like [Cucumis sativus] Length = 875 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 133 RIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 RI+T+EDF K HG+LL ASGLP+SLH +LF+KLTS+T Sbjct: 6 RIQTFEDFFKVHGLLLTASGLPQSLHRQLFQKLTSET 42 >ref|XP_004144031.1| PREDICTED: tubulin--tyrosine ligase-like protein 12-like [Cucumis sativus] Length = 875 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 133 RIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 RI+T+EDF K HG+LL ASGLP+SLH +LF+KLTS+T Sbjct: 6 RIQTFEDFFKVHGLLLTASGLPQSLHRQLFQKLTSET 42 >ref|XP_004288983.1| PREDICTED: tubulin--tyrosine ligase-like protein 12-like [Fragaria vesca subsp. vesca] Length = 860 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 124 TVSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTS 237 + +RIETYEDFVK H +LL ASGLP+SLH +LF+KL S Sbjct: 2 SATRIETYEDFVKVHALLLTASGLPQSLHRRLFQKLLS 39 >gb|ESQ33251.1| hypothetical protein EUTSA_v10003638mg [Eutrema salsugineum] Length = 867 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +1 Query: 130 SRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 ++IE+ EDFVK HG+LLA+SGLP+ LH +LFEKL S T Sbjct: 3 NKIESLEDFVKVHGILLASSGLPQKLHRRLFEKLASDT 40 >ref|XP_002889147.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297334988|gb|EFH65406.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 854 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = +1 Query: 127 VSRIETYEDFVKAHGVLLAASGLPRSLHYKLFEKLTSKT 243 +S+IE+++DFVK HG+LLAASGLP L+ +LF+KL S T Sbjct: 1 MSKIESFDDFVKVHGILLAASGLPSKLYSRLFQKLASDT 39