BLASTX nr result
ID: Jatropha_contig00039460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039460 (618 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516033.1| conserved hypothetical protein [Ricinus comm... 65 2e-08 gb|ESW22622.1| hypothetical protein PHAVU_005G168300g [Phaseolus... 64 4e-08 gb|AGV54202.1| hypothetical protein [Phaseolus vulgaris] 64 4e-08 gb|ESR40201.1| hypothetical protein CICLE_v10026158mg [Citrus cl... 63 7e-08 gb|ESR40200.1| hypothetical protein CICLE_v10026158mg [Citrus cl... 63 7e-08 gb|EOY26801.1| Uncharacterized protein TCM_028754 [Theobroma cacao] 63 7e-08 ref|XP_004486742.1| PREDICTED: uncharacterized protein LOC101509... 63 7e-08 ref|XP_004235669.1| PREDICTED: uncharacterized protein LOC101263... 63 7e-08 ref|XP_004141769.1| PREDICTED: uncharacterized protein LOC101220... 63 7e-08 ref|XP_003597750.1| hypothetical protein MTR_2g101870 [Medicago ... 63 7e-08 ref|NP_001241341.1| uncharacterized protein LOC100818121 [Glycin... 63 7e-08 ref|XP_002284456.1| PREDICTED: uncharacterized protein LOC100261... 63 7e-08 gb|EMJ16921.1| hypothetical protein PRUPE_ppa008966mg [Prunus pe... 62 9e-08 ref|XP_002299711.1| predicted protein [Populus trichocarpa] gi|2... 61 2e-07 ref|XP_006343072.1| PREDICTED: uncharacterized protein LOC102588... 61 3e-07 ref|XP_002304204.1| predicted protein [Populus trichocarpa] gi|2... 61 3e-07 ref|XP_004302904.1| PREDICTED: uncharacterized protein LOC101293... 59 8e-07 gb|ERM98590.1| hypothetical protein AMTR_s00109p00054230 [Ambore... 57 5e-06 >ref|XP_002516033.1| conserved hypothetical protein [Ricinus communis] gi|223544938|gb|EEF46453.1| conserved hypothetical protein [Ricinus communis] Length = 306 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLSTKSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 1 MLSTKSESDITSLAPSSPSRSPKRPVYYVQSPS 33 >gb|ESW22622.1| hypothetical protein PHAVU_005G168300g [Phaseolus vulgaris] gi|561023893|gb|ESW22623.1| hypothetical protein PHAVU_005G168300g [Phaseolus vulgaris] Length = 310 Score = 63.5 bits (153), Expect = 4e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLSTKS+SDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 2 MLSTKSDSDITSLAPSSPSRSPKRPVYYVQSPS 34 >gb|AGV54202.1| hypothetical protein [Phaseolus vulgaris] Length = 309 Score = 63.5 bits (153), Expect = 4e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLSTKS+SDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 2 MLSTKSDSDITSLAPSSPSRSPKRPVYYVQSPS 34 >gb|ESR40201.1| hypothetical protein CICLE_v10026158mg [Citrus clementina] Length = 304 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 2 MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPS 34 >gb|ESR40200.1| hypothetical protein CICLE_v10026158mg [Citrus clementina] Length = 304 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 2 MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPS 34 >gb|EOY26801.1| Uncharacterized protein TCM_028754 [Theobroma cacao] Length = 305 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 2 MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPS 34 >ref|XP_004486742.1| PREDICTED: uncharacterized protein LOC101509865 [Cicer arietinum] Length = 309 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 1 MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPS 33 >ref|XP_004235669.1| PREDICTED: uncharacterized protein LOC101263095 [Solanum lycopersicum] Length = 310 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 ML TKSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 1 MLHTKSESDITSLAPSSPSRSPKRPVYYVQSPS 33 >ref|XP_004141769.1| PREDICTED: uncharacterized protein LOC101220910 [Cucumis sativus] gi|449491744|ref|XP_004158991.1| PREDICTED: uncharacterized protein LOC101226433 [Cucumis sativus] Length = 311 Score = 62.8 bits (151), Expect = 7e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLSTKSESD+TSLAPSSPSRSPK P YYVQSPS Sbjct: 1 MLSTKSESDVTSLAPSSPSRSPKRPTYYVQSPS 33 >ref|XP_003597750.1| hypothetical protein MTR_2g101870 [Medicago truncatula] gi|355486798|gb|AES68001.1| hypothetical protein MTR_2g101870 [Medicago truncatula] Length = 309 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 1 MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPS 33 >ref|NP_001241341.1| uncharacterized protein LOC100818121 [Glycine max] gi|255635604|gb|ACU18152.1| unknown [Glycine max] Length = 309 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 2 MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPS 34 >ref|XP_002284456.1| PREDICTED: uncharacterized protein LOC100261724 [Vitis vinifera] gi|297743254|emb|CBI36121.3| unnamed protein product [Vitis vinifera] Length = 310 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 ML TKSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 1 MLHTKSESDITSLAPSSPSRSPKRPVYYVQSPS 33 >gb|EMJ16921.1| hypothetical protein PRUPE_ppa008966mg [Prunus persica] Length = 312 Score = 62.4 bits (150), Expect = 9e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 M STKSESD+TSLAPSSPSRSPK PVYYVQSPS Sbjct: 2 MHSTKSESDVTSLAPSSPSRSPKVPVYYVQSPS 34 >ref|XP_002299711.1| predicted protein [Populus trichocarpa] gi|222846969|gb|EEE84516.1| hypothetical protein POPTR_0001s18410g [Populus trichocarpa] Length = 298 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESDITSLAPSSPSRSPK PVY+VQSPS Sbjct: 1 MLSAKSESDITSLAPSSPSRSPKRPVYFVQSPS 33 >ref|XP_006343072.1| PREDICTED: uncharacterized protein LOC102588977 [Solanum tuberosum] Length = 310 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 ML KSESDITSLAPSSPSRSPK PVYYVQSPS Sbjct: 1 MLHAKSESDITSLAPSSPSRSPKRPVYYVQSPS 33 >ref|XP_002304204.1| predicted protein [Populus trichocarpa] gi|222841636|gb|EEE79183.1| hypothetical protein POPTR_0003s05170g [Populus trichocarpa] Length = 309 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESDI SLAPSSPSRSPK PVYYVQSPS Sbjct: 1 MLSAKSESDIASLAPSSPSRSPKRPVYYVQSPS 33 >ref|XP_004302904.1| PREDICTED: uncharacterized protein LOC101293317 [Fragaria vesca subsp. vesca] Length = 316 Score = 59.3 bits (142), Expect = 8e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 520 MLSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 MLS KSESD+TSLA SSPSRSPK PVYYVQSPS Sbjct: 1 MLSAKSESDMTSLAASSPSRSPKVPVYYVQSPS 33 >gb|ERM98590.1| hypothetical protein AMTR_s00109p00054230 [Amborella trichopoda] Length = 313 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 523 LSTKSESDITSLAPSSPSRSPKCPVYYVQSPS 618 + KS+SD+TSLAPSSPSRSPK PVYYVQSPS Sbjct: 1 MHAKSDSDVTSLAPSSPSRSPKRPVYYVQSPS 32