BLASTX nr result
ID: Jatropha_contig00039427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039427 (656 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 83 8e-14 gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma ... 82 2e-13 ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496... 78 2e-12 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 78 2e-12 ref|NP_001117603.1| conserved peptide upstream open reading fram... 75 1e-11 gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus... 73 6e-11 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 72 2e-10 ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493... 71 3e-10 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 70 5e-10 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 67 3e-09 ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isofo... 67 3e-09 ref|NP_001119115.1| conserved peptide upstream open reading fram... 65 2e-08 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 64 3e-08 ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515... 62 1e-07 ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 62 1e-07 ref|XP_003527682.1| PREDICTED: uncharacterized protein LOC100809... 62 1e-07 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 62 2e-07 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 61 3e-07 gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus... 59 2e-06 ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago tru... 58 3e-06 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 82.8 bits (203), Expect = 8e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 40 >gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 81.6 bits (200), Expect = 2e-13 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 MSPV+SEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496764 [Cicer arietinum] Length = 41 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 MSPVLSEILRSGF+I+SSL+RRTHLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILRSGFIIDSSLKRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 77.8 bits (190), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 281 FMSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 FMSPV+SEILRSG I+SSLRRRTHLVQSFSVVFLYWFYVF Sbjct: 12 FMSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVF 52 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 MSPV+SEILRSG I+SSLRRRTHLVQSFSVVFLYWFYVF Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVF 40 >gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] Length = 42 Score = 73.2 bits (178), Expect = 6e-11 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 287 SPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 SPV+SEIL SGF INSSLRRRTHLVQSFSVVFL+WFYVF Sbjct: 3 SPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVF 41 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] Length = 41 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 M+PV+SE+L SGF INS+LRR THLVQSFSVVFLYWFYVF Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVF 40 >ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493326 [Cicer arietinum] Length = 54 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 MS +LSE L SGF+INSS RRRTHLVQSFS+VFLYWFYVF Sbjct: 1 MSTILSEFLLSGFIINSSFRRRTHLVQSFSLVFLYWFYVF 40 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 70.1 bits (170), Expect = 5e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 MSPV+ EI SGFMINS+LRRRTHLVQSFSVVFLYWFY+F Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWFYIF 38 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFY 397 MS +LSE+ SGFMINS+ RRRTHLVQSFSVVFLYWFY Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWFY 38 >ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isoform X2 [Setaria italica] Length = 147 Score = 67.4 bits (163), Expect = 3e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 MS +LSE + SGFMINS+LRR THLV SFSVVFLYWFYVF Sbjct: 1 MSQILSEAILSGFMINSTLRRGTHLVLSFSVVFLYWFYVF 40 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/39 (79%), Positives = 35/39 (89%), Gaps = 1/39 (2%) Frame = +2 Query: 284 MSPV-LSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFY 397 MSP+ LSEI SGFM+NS++RRRTHLVQSFSVVFLYW Y Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLY 39 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFY 397 MS +L+E+ GFMINS+ RRRTHLVQSFSVVFLYWFY Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWFY 38 >ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515270 [Cicer arietinum] gi|561009041|gb|ESW07948.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] Length = 41 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFY 397 M P+LSEI SG MINS++RRRTHLVQSFSV FLYW Y Sbjct: 1 MYPILSEIFFSGCMINSTVRRRTHLVQSFSVAFLYWLY 38 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFY 397 MSP LSE+L S MINS+ RRRTHLVQSFSVVFLYW Y Sbjct: 1 MSPTLSELLLSECMINSTYRRRTHLVQSFSVVFLYWLY 38 >ref|XP_003527682.1| PREDICTED: uncharacterized protein LOC100809564 [Glycine max] Length = 52 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +2 Query: 296 LSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 403 LSE +R FMINSS RRRTHLVQSFSVVFLYWFYVF Sbjct: 6 LSEFIR--FMINSSFRRRTHLVQSFSVVFLYWFYVF 39 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein AT2G18162 [Arabidopsis thaliana] Length = 41 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFY 397 M+PVL EIL SG + S+L RRTHLVQSFSVVFLYWFY Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWFY 38 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFY 397 M +LSEI SG MINS++RRRTHLVQSFSVVFLYW Y Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYWLY 38 >gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] Length = 41 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFY 397 M +LSE+ SG MINS++RRRTHLVQSFSV FLYW Y Sbjct: 1 MYSILSELFFSGCMINSTVRRRTHLVQSFSVAFLYWLY 38 >ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago truncatula] gi|355493019|gb|AES74222.1| BZIP transcription factor ATB2 [Medicago truncatula] Length = 209 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +2 Query: 284 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYV 400 M +LSEI SG MINS++RRRTHLVQSFSVVFLY F+V Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYCFWV 39