BLASTX nr result
ID: Jatropha_contig00039406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039406 (666 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR66118.1| hypothetical protein CICLE_v10007237mg [Citrus cl... 43 1e-06 >gb|ESR66118.1| hypothetical protein CICLE_v10007237mg [Citrus clementina] Length = 1749 Score = 42.7 bits (99), Expect(2) = 1e-06 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -1 Query: 291 IGESILFTSPTQFNRFVLLRCRSIS 217 IG +LFTSPT FNRFVLLRC SIS Sbjct: 115 IGNWVLFTSPTAFNRFVLLRCPSIS 139 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 25/55 (45%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = -3 Query: 217 FEGIELLEDVNDS--QRGQGSVTLNSGRIQVR------XXXXXXGLEEKLMYQRV 77 FEG +LLEDVN+ + V LNSGRIQ R +E KL YQRV Sbjct: 140 FEGSDLLEDVNEKLIKEDTHFVRLNSGRIQARTGAVRDGGETESEMEGKLEYQRV 194