BLASTX nr result
ID: Jatropha_contig00039254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039254 (588 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520146.1| homeobox protein, putative [Ricinus communis... 74 4e-11 >ref|XP_002520146.1| homeobox protein, putative [Ricinus communis] gi|223540638|gb|EEF42201.1| homeobox protein, putative [Ricinus communis] Length = 305 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/46 (73%), Positives = 42/46 (91%), Gaps = 2/46 (4%) Frame = +3 Query: 456 MAGDKVSDGSNI--TVLLQNDTLPCDSLWIPSSSASLHGAKSIVNF 587 MAGDKVSD SN+ TVLLQNDTLPC+ +W+P+SSA++HGAKS+VNF Sbjct: 1 MAGDKVSDVSNVMTTVLLQNDTLPCEPVWVPASSATIHGAKSMVNF 46