BLASTX nr result
ID: Jatropha_contig00039228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039228 (697 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528375.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 >ref|XP_002528375.1| conserved hypothetical protein [Ricinus communis] gi|223532243|gb|EEF34047.1| conserved hypothetical protein [Ricinus communis] Length = 83 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 600 VKDANGFTNKPLITVDSEKLENLTDDREDYSE 695 V D NGFTNKPL+TVDSEK+EN +DDREDYSE Sbjct: 5 VMDTNGFTNKPLMTVDSEKVENHSDDREDYSE 36