BLASTX nr result
ID: Jatropha_contig00039193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039193 (676 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529828.1| hypothetical protein RCOM_0258490 [Ricinus c... 69 1e-09 >ref|XP_002529828.1| hypothetical protein RCOM_0258490 [Ricinus communis] gi|223530656|gb|EEF32529.1| hypothetical protein RCOM_0258490 [Ricinus communis] Length = 293 Score = 68.9 bits (167), Expect = 1e-09 Identities = 38/75 (50%), Positives = 43/75 (57%) Frame = +3 Query: 450 MFSLQTITMPKSFSPLCSINAEPNWFFFSSIYPQIPACNLALSTYSHLKYGLPSLTPCGH 629 MF LQT+TMPK FSPLCS+N EPN F S +PQ LST L+Y L S GH Sbjct: 1 MFFLQTVTMPKFFSPLCSVNIEPNVLFLPSNFPQSSLYTHTLSTRCCLEYVLLSSPHRGH 60 Query: 630 SIKLFPCFAASMNPD 674 I+ F C A S D Sbjct: 61 IIRPFSCLAYSRKSD 75