BLASTX nr result
ID: Jatropha_contig00039113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039113 (611 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004296652.1| PREDICTED: cytochrome b5 isoform B-like [Fra... 61 3e-07 ref|XP_003552132.1| PREDICTED: cytochrome b5-like [Glycine max] 60 6e-07 gb|EOY05313.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao] 58 2e-06 ref|XP_002265677.1| PREDICTED: cytochrome b5 [Vitis vinifera] gi... 58 2e-06 gb|AAT84459.1| cytochrome b5 isoform Cb5-B [Vernicia fordii] 57 3e-06 gb|EOX93935.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao] 56 6e-06 ref|XP_002521096.1| cytochrome B5 isoform 1, putative [Ricinus c... 56 6e-06 emb|CAA50575.1| cytochrome b5 [Nicotiana tabacum] 56 8e-06 ref|XP_002518143.1| cytochrome B5 isoform 1, putative [Ricinus c... 56 8e-06 sp|P49098.1|CYB5_TOBAC RecName: Full=Cytochrome b5 56 8e-06 >ref|XP_004296652.1| PREDICTED: cytochrome b5 isoform B-like [Fragaria vesca subsp. vesca] Length = 134 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 MGG+EKVFTLA+VS HNTPKDCWLII+GKV Sbjct: 1 MGGDEKVFTLAQVSDHNTPKDCWLIINGKV 30 >ref|XP_003552132.1| PREDICTED: cytochrome b5-like [Glycine max] Length = 138 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 MGGE KV+TLAEVS+HNT KDCWLIIDGKV Sbjct: 1 MGGERKVYTLAEVSEHNTSKDCWLIIDGKV 30 >gb|EOY05313.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao] Length = 132 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 MGG+ K+FTLA+VS+HNTPKDCWLII+GKV Sbjct: 1 MGGDGKLFTLAQVSEHNTPKDCWLIINGKV 30 >ref|XP_002265677.1| PREDICTED: cytochrome b5 [Vitis vinifera] gi|147818083|emb|CAN78289.1| hypothetical protein VITISV_008139 [Vitis vinifera] gi|297744338|emb|CBI37308.3| unnamed protein product [Vitis vinifera] Length = 133 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 527 GEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 GE KV+TLAEVS+HNTPKDCWLIIDGKV Sbjct: 2 GEGKVYTLAEVSEHNTPKDCWLIIDGKV 29 >gb|AAT84459.1| cytochrome b5 isoform Cb5-B [Vernicia fordii] Length = 134 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 MGG++KVFTLA+VS+HN PKDCWLII GKV Sbjct: 1 MGGDKKVFTLAQVSQHNNPKDCWLIIGGKV 30 >gb|EOX93935.1| Cytochrome B5, n4,ATCB5-B,CB5-B [Theobroma cacao] Length = 135 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 MGG KV+TLAEVS+HN PKDCWL+I+GKV Sbjct: 1 MGGRGKVYTLAEVSQHNNPKDCWLVIEGKV 30 >ref|XP_002521096.1| cytochrome B5 isoform 1, putative [Ricinus communis] gi|223539665|gb|EEF41247.1| cytochrome B5 isoform 1, putative [Ricinus communis] Length = 136 Score = 56.2 bits (134), Expect = 6e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 MGG+ KV+TLA+VS+HN+PKDCWL+I+GKV Sbjct: 1 MGGQGKVYTLADVSEHNSPKDCWLVIEGKV 30 >emb|CAA50575.1| cytochrome b5 [Nicotiana tabacum] Length = 139 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 MGGE KVFTLAEVS+HN KDCWL+I GKV Sbjct: 4 MGGETKVFTLAEVSQHNNAKDCWLVISGKV 33 >ref|XP_002518143.1| cytochrome B5 isoform 1, putative [Ricinus communis] gi|223542739|gb|EEF44276.1| cytochrome B5 isoform 1, putative [Ricinus communis] Length = 140 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 M GE KVFTLA+VS+HN PKDCWLII+GKV Sbjct: 1 MSGEGKVFTLAQVSEHNNPKDCWLIINGKV 30 >sp|P49098.1|CYB5_TOBAC RecName: Full=Cytochrome b5 Length = 136 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 521 MGGEEKVFTLAEVSKHNTPKDCWLIIDGKV 610 MGGE KVFTLAEVS+HN KDCWL+I GKV Sbjct: 1 MGGETKVFTLAEVSQHNNAKDCWLVISGKV 30