BLASTX nr result
ID: Jatropha_contig00038884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038884 (741 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW18985.1| hypothetical protein PHAVU_006G087400g [Phaseolus... 39 6e-06 >gb|ESW18985.1| hypothetical protein PHAVU_006G087400g [Phaseolus vulgaris] Length = 73 Score = 39.3 bits (90), Expect(2) = 6e-06 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -3 Query: 679 NQISGLDSPKRKDRSICSYSIIWGNNHPFH 590 +QI+ L K K+R++CS SI WGNNH H Sbjct: 2 DQINWLGFSKEKNRTVCSASITWGNNHHIH 31 Score = 37.7 bits (86), Expect(2) = 6e-06 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = -1 Query: 552 ITKTTDQISGFDSL*RKDRSVCSTSFIWGNNHPFHR 445 I +T DQI K+R+VCS S WGNNH H+ Sbjct: 30 IHQTMDQIHWLGFSKEKNRTVCSASITWGNNHHIHQ 65