BLASTX nr result
ID: Jatropha_contig00038846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038846 (674 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529112.1| lupus la ribonucleoprotein, putative [Ricinu... 60 6e-07 >ref|XP_002529112.1| lupus la ribonucleoprotein, putative [Ricinus communis] gi|223531463|gb|EEF33296.1| lupus la ribonucleoprotein, putative [Ricinus communis] Length = 524 Score = 60.1 bits (144), Expect = 6e-07 Identities = 38/83 (45%), Positives = 48/83 (57%) Frame = +1 Query: 196 YVPVRXXXXXXXXXXXXYVAVQYHGNQHRHQDPNQNQYASGSKKEEDAELVVRKDVASSD 375 YVPVR YV +QYHGNQ+ H Y + EE+ E +K+VASSD Sbjct: 144 YVPVRNHNQNSSQ----YVPLQYHGNQNHH-------YVKKGQLEEEVE---KKEVASSD 189 Query: 376 HATKSDRNSGLSDEAVQKLLNQV 444 H +K+DRN +DE +QKLLNQV Sbjct: 190 HMSKNDRNG--NDEPMQKLLNQV 210