BLASTX nr result
ID: Jatropha_contig00038704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038704 (337 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525511.1| aspartate kinase, putative [Ricinus communis... 77 2e-12 >ref|XP_002525511.1| aspartate kinase, putative [Ricinus communis] gi|223535190|gb|EEF36869.1| aspartate kinase, putative [Ricinus communis] Length = 920 Score = 77.0 bits (188), Expect = 2e-12 Identities = 47/78 (60%), Positives = 55/78 (70%), Gaps = 2/78 (2%) Frame = +1 Query: 109 AYTASIFNTLCISSSSTLLHDSK--TKKKISPSRFSASPFLSRSPLFRTDFFVSQWGRRE 282 +Y+ASI +T I +S+ L HDS+ TKKKIS SRFS L SPL RT +SQ GRRE Sbjct: 3 SYSASISSTNRILTSNALSHDSRPNTKKKISTSRFSTLSLLPPSPLLRTAL-LSQCGRRE 61 Query: 283 STCVHVSSPVKAVLLDES 336 S C HVSS +KAVLLDES Sbjct: 62 SACGHVSSSIKAVLLDES 79