BLASTX nr result
ID: Jatropha_contig00038592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038592 (678 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528526.1| transcription factor, putative [Ricinus comm... 54 5e-08 >ref|XP_002528526.1| transcription factor, putative [Ricinus communis] gi|223532028|gb|EEF33838.1| transcription factor, putative [Ricinus communis] Length = 656 Score = 54.3 bits (129), Expect(2) = 5e-08 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +3 Query: 186 MDNAKENEDESELSLPHPPGPDMPIEAQLVPAIEHLDEGSPPHLVPMDQDEKKPSEN 356 M +AKENEDES HP G DM I+A+ ++ + S PH VPMDQD+ PSEN Sbjct: 1 MGSAKENEDESA----HPSGTDMAIDAE--QPLQQTEHASSPHPVPMDQDDPVPSEN 51 Score = 29.3 bits (64), Expect(2) = 5e-08 Identities = 24/87 (27%), Positives = 34/87 (39%), Gaps = 19/87 (21%) Frame = +2 Query: 473 RNKKSQTAVVPTNNFETNPQ-------------------QPQTELVTSDNNVAQTEAMAN 595 RN SQT P ++ PQ Q QTE D +TEA + Sbjct: 52 RNPSSQTIAAPNDHNNVLPQSHSETSSINNTLESKSTMQQSQTEADLGDPQKLETEAAPD 111 Query: 596 DGMGELRNHTQKPQTEAVPNEDDMGLK 676 +L+ + Q E VPN++ GL+ Sbjct: 112 TNSAQLKTPS---QDEIVPNDNIEGLR 135