BLASTX nr result
ID: Jatropha_contig00038541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038541 (694 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320810.1| predicted protein [Populus trichocarpa] 74 4e-11 gb|EEE81868.2| hypothetical protein POPTR_0002s16300g [Populus t... 74 5e-11 ref|XP_002302595.1| predicted protein [Populus trichocarpa] 74 5e-11 ref|XP_004510765.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 73 9e-11 ref|XP_002511886.1| protein binding protein, putative [Ricinus c... 72 2e-10 gb|EOX95912.1| RING-H2 finger B1A [Theobroma cacao] 71 2e-10 ref|XP_004306756.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 70 5e-10 ref|XP_004492767.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 69 1e-09 gb|EMJ10793.1| hypothetical protein PRUPE_ppa011402mg [Prunus pe... 69 1e-09 gb|EEE99125.2| hypothetical protein POPTR_0014s08290g [Populus t... 69 1e-09 gb|EMJ19656.1| hypothetical protein PRUPE_ppa011833mg [Prunus pe... 69 2e-09 ref|XP_003528846.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 69 2e-09 emb|CBI34360.3| unnamed protein product [Vitis vinifera] 69 2e-09 ref|XP_002280000.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 69 2e-09 ref|XP_004954429.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 68 2e-09 gb|EOY24788.1| RING/U-box superfamily protein, putative [Theobro... 68 2e-09 ref|XP_002509832.1| protein binding protein, putative [Ricinus c... 68 2e-09 ref|XP_004492769.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 68 3e-09 ref|XP_004983408.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 67 4e-09 gb|EMT14269.1| E3 ubiquitin-protein ligase [Aegilops tauschii] 67 4e-09 >ref|XP_002320810.1| predicted protein [Populus trichocarpa] Length = 186 Score = 73.9 bits (180), Expect = 4e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQVC 146 K +T CEHHFHLSCILEWMERSDTCPICDQVC Sbjct: 153 KHITNCEHHFHLSCILEWMERSDTCPICDQVC 184 >gb|EEE81868.2| hypothetical protein POPTR_0002s16300g [Populus trichocarpa] Length = 223 Score = 73.6 bits (179), Expect = 5e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQVC 146 K +TKCEHHFHLSCILEWMERSD CPICDQVC Sbjct: 190 KHITKCEHHFHLSCILEWMERSDICPICDQVC 221 >ref|XP_002302595.1| predicted protein [Populus trichocarpa] Length = 185 Score = 73.6 bits (179), Expect = 5e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQVC 146 K +TKCEHHFHLSCILEWMERSD CPICDQVC Sbjct: 152 KHITKCEHHFHLSCILEWMERSDICPICDQVC 183 >ref|XP_004510765.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X1 [Cicer arietinum] gi|502157124|ref|XP_004510766.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X2 [Cicer arietinum] gi|502157126|ref|XP_004510767.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X3 [Cicer arietinum] Length = 232 Score = 72.8 bits (177), Expect = 9e-11 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 8/70 (11%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQVCP--------*EMTLFCRQLVGEFL*KMK 206 K TKCEHHFHL+CILEWMERSD+CPICDQVC M R G F +MK Sbjct: 153 KSFTKCEHHFHLACILEWMERSDSCPICDQVCQFTSIFLVNITMKTEKRVFFGFFCWQMK 212 Query: 207 SLSYLSFPHI 236 +++ L FPH+ Sbjct: 213 TVNTL-FPHM 221 >ref|XP_002511886.1| protein binding protein, putative [Ricinus communis] gi|223549066|gb|EEF50555.1| protein binding protein, putative [Ricinus communis] Length = 199 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 KF TKCEHHFHLSCILEWMERSDTCPICDQ Sbjct: 161 KFFTKCEHHFHLSCILEWMERSDTCPICDQ 190 >gb|EOX95912.1| RING-H2 finger B1A [Theobroma cacao] Length = 190 Score = 71.2 bits (173), Expect(2) = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 K +TKCEHHFHLSCILEWMERSDTCPICDQ Sbjct: 151 KLITKCEHHFHLSCILEWMERSDTCPICDQ 180 Score = 20.4 bits (41), Expect(2) = 2e-10 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 25 LAEYDTQNPNL 57 L EYD++NP L Sbjct: 142 LEEYDSENPKL 152 >ref|XP_004306756.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform 1 [Fragaria vesca subsp. vesca] Length = 208 Score = 70.5 bits (171), Expect = 5e-10 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQVCP*EMTLF 167 +F TKC HH+HLSCILEWMERSD CPICDQVC + ++ Sbjct: 152 EFTTKCGHHYHLSCILEWMERSDACPICDQVCHLQQVIY 190 >ref|XP_004492767.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X1 [Cicer arietinum] gi|502105281|ref|XP_004492768.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X2 [Cicer arietinum] Length = 205 Score = 69.3 bits (168), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQV 143 K +TKCEHHFHLSCILEWMERSD+CPICDQV Sbjct: 153 KNLTKCEHHFHLSCILEWMERSDSCPICDQV 183 >gb|EMJ10793.1| hypothetical protein PRUPE_ppa011402mg [Prunus persica] Length = 212 Score = 68.6 bits (166), Expect(2) = 1e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 K TKCEHHFHL+CILEWMERSDTCP+CDQ Sbjct: 175 KITTKCEHHFHLACILEWMERSDTCPVCDQ 204 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 25 LAEYDTQNPNLS 60 L EYD QNP ++ Sbjct: 166 LEEYDAQNPKIT 177 >gb|EEE99125.2| hypothetical protein POPTR_0014s08290g [Populus trichocarpa] Length = 194 Score = 68.9 bits (167), Expect = 1e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 K +T CEHHFHLSCILEWMERSDTCPICDQ Sbjct: 153 KHITNCEHHFHLSCILEWMERSDTCPICDQ 182 >gb|EMJ19656.1| hypothetical protein PRUPE_ppa011833mg [Prunus persica] Length = 194 Score = 68.6 bits (166), Expect = 2e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 KF+TKCEHH+HL CILEWMERSD CPICDQ Sbjct: 155 KFITKCEHHYHLCCILEWMERSDACPICDQ 184 >ref|XP_003528846.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Glycine max] Length = 191 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQVCP*EMTL 164 K +TKCEHHFHLSCILEWMERSD+CPICDQ + TL Sbjct: 153 KTLTKCEHHFHLSCILEWMERSDSCPICDQEMIFDQTL 190 >emb|CBI34360.3| unnamed protein product [Vitis vinifera] Length = 227 Score = 68.6 bits (166), Expect = 2e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 K VTKCEHHFHL+CILEWMERSDTCP+CD+ Sbjct: 188 KIVTKCEHHFHLACILEWMERSDTCPVCDK 217 >ref|XP_002280000.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Vitis vinifera] Length = 213 Score = 68.6 bits (166), Expect = 2e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 K VTKCEHHFHL+CILEWMERSDTCP+CD+ Sbjct: 174 KIVTKCEHHFHLACILEWMERSDTCPVCDK 203 >ref|XP_004954429.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Setaria italica] Length = 171 Score = 68.2 bits (165), Expect = 2e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 57 VTKCEHHFHLSCILEWMERSDTCPICDQV 143 +TKCEHHFHL CILEWMERSDTCP+CDQ+ Sbjct: 135 ITKCEHHFHLCCILEWMERSDTCPVCDQI 163 >gb|EOY24788.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 211 Score = 68.2 bits (165), Expect = 2e-09 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 K +TKCEHHFHL+CILEWMERSDTCP+CD+ Sbjct: 174 KIITKCEHHFHLACILEWMERSDTCPVCDK 203 >ref|XP_002509832.1| protein binding protein, putative [Ricinus communis] gi|223549731|gb|EEF51219.1| protein binding protein, putative [Ricinus communis] Length = 212 Score = 68.2 bits (165), Expect = 2e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 K TKCEHHFHLSCILEWMERSDTCP+CD+ Sbjct: 174 KITTKCEHHFHLSCILEWMERSDTCPVCDK 203 >ref|XP_004492769.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X3 [Cicer arietinum] Length = 186 Score = 67.8 bits (164), Expect = 3e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 51 KFVTKCEHHFHLSCILEWMERSDTCPICDQ 140 K +TKCEHHFHLSCILEWMERSD+CPICDQ Sbjct: 153 KNLTKCEHHFHLSCILEWMERSDSCPICDQ 182 >ref|XP_004983408.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X1 [Setaria italica] gi|514817372|ref|XP_004983409.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X2 [Setaria italica] Length = 175 Score = 67.4 bits (163), Expect = 4e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 57 VTKCEHHFHLSCILEWMERSDTCPICDQV 143 VTKC+HHFHL CILEWMERSDTCP+CDQ+ Sbjct: 139 VTKCDHHFHLCCILEWMERSDTCPVCDQI 167 >gb|EMT14269.1| E3 ubiquitin-protein ligase [Aegilops tauschii] Length = 221 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 57 VTKCEHHFHLSCILEWMERSDTCPICDQVCP*EMTLFCRQ 176 +TKCEHHFHL CILEWMERS+TCP+CDQ L CRQ Sbjct: 159 ITKCEHHFHLCCILEWMERSETCPVCDQ-------LICRQ 191