BLASTX nr result
ID: Jatropha_contig00038351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038351 (483 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP62048.1| hypothetical protein POPTR_0004s11060g [Populus t... 84 2e-14 ref|XP_002533596.1| conserved hypothetical protein [Ricinus comm... 63 4e-08 >gb|ERP62048.1| hypothetical protein POPTR_0004s11060g [Populus trichocarpa] Length = 475 Score = 84.0 bits (206), Expect = 2e-14 Identities = 55/138 (39%), Positives = 73/138 (52%), Gaps = 29/138 (21%) Frame = +3 Query: 156 LYSLQKNSIISFLHKKPEILSVNSPKRSTIMWRNVAKQGV----SKIRWYPP-------- 299 ++S +K + KKP ILS+ + K ST+MWRNVAKQ + SK +P Sbjct: 8 IFSTKKIDPLIAFDKKPSILSLINSKPSTVMWRNVAKQAILKPQSKSLNFPSFPRTHSFL 67 Query: 300 ---------------NISNSQPGIC--RLGEILTHEEYMGKPTFGFLRNCCCSNRYGMSI 428 +++NS P +C R+GEI THE+YMGKP+FGFLRN SN Sbjct: 68 GAPQEPIFFEKSKFHSVNNSSPQLCFRRIGEISTHEDYMGKPSFGFLRNGDSSN------ 121 Query: 429 SMSSGYLHSGISPRGYVN 482 G L SG+ PRGYV+ Sbjct: 122 ----GNLCSGLCPRGYVS 135 >ref|XP_002533596.1| conserved hypothetical protein [Ricinus communis] gi|223526525|gb|EEF28787.1| conserved hypothetical protein [Ricinus communis] Length = 395 Score = 62.8 bits (151), Expect = 4e-08 Identities = 42/108 (38%), Positives = 52/108 (48%), Gaps = 29/108 (26%) Frame = +3 Query: 246 MWRNVAKQGVS-----------------------------KIRWYPPNISNSQPGICRLG 338 MWRNVAKQ +S K + P +S G CRLG Sbjct: 1 MWRNVAKQTISRAQSKSLSSHPLSSTYSFLGLSQEPSFTDKCKLSPLYACSSLVGFCRLG 60 Query: 339 EILTHEEYMGKPTFGFLRNCCCSNRYGMSISMSSGYLHSGISPRGYVN 482 EI+ +E++MGKP FG + N SN M SM +GYL SG PRGYV+ Sbjct: 61 EIVPYEDFMGKPGFGLVGNKDNSNSSHM--SMCNGYLCSGFYPRGYVS 106