BLASTX nr result
ID: Jatropha_contig00038344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038344 (385 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY17281.1| Chaperone DnaJ-domain superfamily protein, putati... 63 8e-11 >gb|EOY17281.1| Chaperone DnaJ-domain superfamily protein, putative [Theobroma cacao] Length = 132 Score = 63.2 bits (152), Expect(2) = 8e-11 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 8/54 (14%) Frame = +3 Query: 111 TNVYAILGRSPFSSKSDIKVVYKRLALKYH--------FPGRDKPFRKIKLAYE 248 T YA+LG +PF+SKSD+K YKRLALKYH PG+DK FR+IK AYE Sbjct: 39 TTHYALLGLTPFASKSDVKQAYKRLALKYHPDVYKGEDVPGKDKAFREIKSAYE 92 Score = 28.9 bits (63), Expect(2) = 8e-11 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Frame = +1 Query: 250 LMLKFEEQELQPAKDYDEWG-----MGFE 321 LM K+E ELQ KD+DE+ MGFE Sbjct: 94 LMQKYEADELQTEKDFDEYDDWEEWMGFE 122