BLASTX nr result
ID: Jatropha_contig00038305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038305 (646 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277026.1| PREDICTED: uncharacterized protein LOC100247... 68 2e-09 >ref|XP_002277026.1| PREDICTED: uncharacterized protein LOC100247068 [Vitis vinifera] Length = 497 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +3 Query: 507 QKITNTGALCCVASGPHVVNSPTGGGGSLNNHDEPHWRTNSSFSPP 644 +KI NTGALCCVA+GPH + TGG S +H EP WRTNSSFSPP Sbjct: 15 EKIANTGALCCVAAGPHGAKTNTGGDHS-TDHGEPQWRTNSSFSPP 59