BLASTX nr result
ID: Jatropha_contig00038257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038257 (515 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528483.1| conserved hypothetical protein [Ricinus comm... 59 8e-07 >ref|XP_002528483.1| conserved hypothetical protein [Ricinus communis] gi|223532092|gb|EEF33900.1| conserved hypothetical protein [Ricinus communis] Length = 698 Score = 58.5 bits (140), Expect = 8e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 414 DSVLNSKDYTLLKDFRMEVEIKGGNFSFSFWIYL 515 D+V+N+KDY LLKDFRME+E++GG SF FW+YL Sbjct: 4 DNVINTKDYILLKDFRMEIELQGGTLSFCFWVYL 37