BLASTX nr result
ID: Jatropha_contig00038190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038190 (630 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526061.1| multidrug resistance pump, putative [Ricinus... 65 2e-08 >ref|XP_002526061.1| multidrug resistance pump, putative [Ricinus communis] gi|223534642|gb|EEF36338.1| multidrug resistance pump, putative [Ricinus communis] Length = 589 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = +1 Query: 460 RGSFLAPSFSRTSPLFSFFTKFPLLSIFRSVSNNFRCPLLHYHSCHFPKPLHYIQA 627 RGS APS +R SPLFSFFTK P S F++ + R P LHYH FPKP+ IQA Sbjct: 3 RGSSFAPSLNRASPLFSFFTKIPFFSSFQNNFHTIRRPFLHYHYYVFPKPVCNIQA 58