BLASTX nr result
ID: Jatropha_contig00038181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038181 (637 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518909.1| alpha/beta hydrolase domain containing prote... 62 1e-07 emb|CBI34585.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002280182.1| PREDICTED: embryogenesis-associated protein ... 61 2e-07 gb|ESW03470.1| hypothetical protein PHAVU_011G016800g [Phaseolus... 60 5e-07 gb|EEE78669.2| hypothetical protein POPTR_0003s14650g [Populus t... 60 7e-07 ref|XP_002303690.1| predicted protein [Populus trichocarpa] 60 7e-07 ref|XP_003539999.1| PREDICTED: embryogenesis-associated protein ... 59 1e-06 gb|AAM65108.1| putative LEA protein [Arabidopsis thaliana] 59 1e-06 ref|XP_004953291.1| PREDICTED: embryogenesis-associated protein ... 58 2e-06 ref|XP_004506339.1| PREDICTED: embryogenesis-associated protein ... 58 2e-06 gb|EMS54940.1| Embryogenesis-associated protein EMB8 [Triticum u... 58 2e-06 dbj|BAD43666.1| putative LEA protein [Arabidopsis thaliana] 58 2e-06 ref|NP_001047583.2| Os02g0649400 [Oryza sativa Japonica Group] g... 58 2e-06 dbj|BAJ97516.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 2e-06 dbj|BAJ96731.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 2e-06 gb|EEE57479.1| hypothetical protein OsJ_07727 [Oryza sativa Japo... 58 2e-06 gb|EEC73699.1| hypothetical protein OsI_08285 [Oryza sativa Indi... 58 2e-06 ref|NP_190648.1| esterase/lipase/thioesterase family protein [Ar... 58 2e-06 ref|XP_004163575.1| PREDICTED: embryogenesis-associated protein ... 58 2e-06 ref|XP_004143840.1| PREDICTED: embryogenesis-associated protein ... 58 2e-06 >ref|XP_002518909.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] gi|223541896|gb|EEF43442.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] Length = 425 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/55 (63%), Positives = 37/55 (67%) Frame = +1 Query: 472 YYERFEISQAYVEFSRLTGSHLLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 YY R S A R LL +QAA DPIAPARAIPREDIK+N NCLLIVTP Sbjct: 315 YYSRSSSSDAIKYVHR----PLLCIQAANDPIAPARAIPREDIKENSNCLLIVTP 365 >emb|CBI34585.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QAA DPIAP+R IPREDIK+NPNCLLIVTP Sbjct: 292 LLCIQAANDPIAPSRGIPREDIKENPNCLLIVTP 325 >ref|XP_002280182.1| PREDICTED: embryogenesis-associated protein EMB8 [Vitis vinifera] Length = 424 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QAA DPIAP+R IPREDIK+NPNCLLIVTP Sbjct: 330 LLCIQAANDPIAPSRGIPREDIKENPNCLLIVTP 363 >gb|ESW03470.1| hypothetical protein PHAVU_011G016800g [Phaseolus vulgaris] Length = 414 Score = 60.1 bits (144), Expect = 5e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QAA DPIAP R IPREDIK+NPNCLLIVTP Sbjct: 331 LLCIQAANDPIAPYRGIPREDIKENPNCLLIVTP 364 >gb|EEE78669.2| hypothetical protein POPTR_0003s14650g [Populus trichocarpa] Length = 427 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QAA DPIAPAR IP EDIK+NPNCLLIVTP Sbjct: 334 LLCIQAANDPIAPARGIPYEDIKENPNCLLIVTP 367 >ref|XP_002303690.1| predicted protein [Populus trichocarpa] Length = 381 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QAA DPIAPAR IP EDIK+NPNCLLIVTP Sbjct: 288 LLCIQAANDPIAPARGIPYEDIKENPNCLLIVTP 321 >ref|XP_003539999.1| PREDICTED: embryogenesis-associated protein EMB8-like [Glycine max] Length = 412 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QAA DPIAP R IPREDI++NPNCLLIVTP Sbjct: 323 LLCIQAANDPIAPNRGIPREDIEENPNCLLIVTP 356 >gb|AAM65108.1| putative LEA protein [Arabidopsis thaliana] Length = 408 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/55 (56%), Positives = 39/55 (70%) Frame = +1 Query: 472 YYERFEISQAYVEFSRLTGSHLLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 YY + S+A ++ R+ LL +QAA DPIAP R IPR+DIK NPNC+LIVTP Sbjct: 306 YYSKSSSSKA-IKHVRIP---LLCIQAANDPIAPERGIPRDDIKSNPNCVLIVTP 356 >ref|XP_004953291.1| PREDICTED: embryogenesis-associated protein EMB8-like [Setaria italica] Length = 434 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QA DPIAP+R IPREDIK NPNCLLIVTP Sbjct: 337 LLCIQADNDPIAPSRGIPREDIKANPNCLLIVTP 370 >ref|XP_004506339.1| PREDICTED: embryogenesis-associated protein EMB8-like [Cicer arietinum] Length = 429 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVT 633 LL +QAA DPIAP+R IPREDIK+NPNCLL+VT Sbjct: 338 LLCIQAANDPIAPSRGIPREDIKENPNCLLVVT 370 >gb|EMS54940.1| Embryogenesis-associated protein EMB8 [Triticum urartu] Length = 400 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QA DPIAP+R IPREDIK NPNCLLIVTP Sbjct: 305 LLCIQADNDPIAPSRGIPREDIKANPNCLLIVTP 338 >dbj|BAD43666.1| putative LEA protein [Arabidopsis thaliana] Length = 408 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/55 (56%), Positives = 39/55 (70%) Frame = +1 Query: 472 YYERFEISQAYVEFSRLTGSHLLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 YY + S+A ++ R+ LL +QAA DPIAP R IPR+DIK NPNC+LIVTP Sbjct: 306 YYSKSSSSKA-IKHVRIP---LLCIQAANDPIAPERGIPRDDIKANPNCVLIVTP 356 >ref|NP_001047583.2| Os02g0649400 [Oryza sativa Japonica Group] gi|49388448|dbj|BAD25578.1| putative late embryonic abundant protein EMB8 [Oryza sativa Japonica Group] gi|255671132|dbj|BAF09497.2| Os02g0649400 [Oryza sativa Japonica Group] Length = 469 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QA DPIAP+R IPREDIK NPNCLLIVTP Sbjct: 349 LLCIQADNDPIAPSRGIPREDIKANPNCLLIVTP 382 >dbj|BAJ97516.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 422 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QA DPIAP+R IPREDIK NPNCLLIVTP Sbjct: 327 LLCIQADNDPIAPSRGIPREDIKANPNCLLIVTP 360 >dbj|BAJ96731.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 432 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QA DPIAP+R IPREDIK NPNCLLIVTP Sbjct: 337 LLCIQADNDPIAPSRGIPREDIKANPNCLLIVTP 370 >gb|EEE57479.1| hypothetical protein OsJ_07727 [Oryza sativa Japonica Group] Length = 300 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QA DPIAP+R IPREDIK NPNCLLIVTP Sbjct: 203 LLCIQADNDPIAPSRGIPREDIKANPNCLLIVTP 236 >gb|EEC73699.1| hypothetical protein OsI_08285 [Oryza sativa Indica Group] Length = 446 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QA DPIAP+R IPREDIK NPNCLLIVTP Sbjct: 349 LLCIQADNDPIAPSRGIPREDIKANPNCLLIVTP 382 >ref|NP_190648.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana] gi|4835230|emb|CAB42908.1| putative LEA protein [Arabidopsis thaliana] gi|332645189|gb|AEE78710.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana] Length = 408 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/55 (56%), Positives = 39/55 (70%) Frame = +1 Query: 472 YYERFEISQAYVEFSRLTGSHLLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 YY + S+A ++ R+ LL +QAA DPIAP R IPR+DIK NPNC+LIVTP Sbjct: 306 YYSKSSSSKA-IKHVRIP---LLCIQAANDPIAPERGIPRDDIKANPNCVLIVTP 356 >ref|XP_004163575.1| PREDICTED: embryogenesis-associated protein EMB8-like [Cucumis sativus] Length = 372 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QAA DPIAP R IPREDI++NPNC+LIVTP Sbjct: 295 LLCIQAANDPIAPNRGIPREDIEENPNCMLIVTP 328 >ref|XP_004143840.1| PREDICTED: embryogenesis-associated protein EMB8-like [Cucumis sativus] Length = 480 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 535 LLKLQAATDPIAPARAIPREDIKKNPNCLLIVTP 636 LL +QAA DPIAP R IPREDI++NPNC+LIVTP Sbjct: 395 LLCIQAANDPIAPNRGIPREDIEENPNCMLIVTP 428