BLASTX nr result
ID: Jatropha_contig00038136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038136 (205 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518954.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 >ref|XP_002518954.1| conserved hypothetical protein [Ricinus communis] gi|223541941|gb|EEF43487.1| conserved hypothetical protein [Ricinus communis] Length = 165 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/52 (67%), Positives = 37/52 (71%) Frame = +2 Query: 50 MVPETAKPTYSSSSFDGVKHKALDREVRDMVNAITSRVSDLQKSGVSHHHQQ 205 M+ ET T SSS D KHK DREVRDMVNAITSRV DL K G SHHH+Q Sbjct: 1 MLSETTNKTTQSSS-DANKHKPFDREVRDMVNAITSRVGDLHKPGASHHHRQ 51