BLASTX nr result
ID: Jatropha_contig00038062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00038062 (653 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531008.1| diphosphoinositol polyphosphate phosphohydro... 62 2e-07 ref|XP_004140308.1| PREDICTED: nudix hydrolase 18, mitochondrial... 57 5e-06 gb|ESR43841.1| hypothetical protein CICLE_v10012837mg [Citrus cl... 57 6e-06 gb|ESR43840.1| hypothetical protein CICLE_v10012837mg [Citrus cl... 57 6e-06 >ref|XP_002531008.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis] gi|223529406|gb|EEF31368.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis] Length = 193 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 155 MVALVSQENNVLPLVSRTGRHLQRYSKGGRRQVVGLVSFNF 277 MVALVSQE + LVSRTGRHLQRYSKGGRRQVVG + + + Sbjct: 1 MVALVSQETVNVALVSRTGRHLQRYSKGGRRQVVGCIPYRY 41 >ref|XP_004140308.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Cucumis sativus] gi|449529539|ref|XP_004171757.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Cucumis sativus] Length = 185 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/38 (81%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +2 Query: 542 CIPYRYKTEKKDSL-NIEEEGFEVLVISSQKGKGMLFP 652 CIPYRYKT KK +L NIEE EVLVISSQKGKGMLFP Sbjct: 35 CIPYRYKTTKKSTLDNIEE--LEVLVISSQKGKGMLFP 70 >gb|ESR43841.1| hypothetical protein CICLE_v10012837mg [Citrus clementina] Length = 163 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +2 Query: 542 CIPYRYKTEKKDSLNIEEEGFEVLVISSQKGKGMLFP 652 CIPYRYK K+ SL+I EE EVLVISSQKGKGMLFP Sbjct: 44 CIPYRYKCVKQ-SLDINEEDLEVLVISSQKGKGMLFP 79 >gb|ESR43840.1| hypothetical protein CICLE_v10012837mg [Citrus clementina] Length = 196 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +2 Query: 542 CIPYRYKTEKKDSLNIEEEGFEVLVISSQKGKGMLFP 652 CIPYRYK K+ SL+I EE EVLVISSQKGKGMLFP Sbjct: 44 CIPYRYKCVKQ-SLDINEEDLEVLVISSQKGKGMLFP 79