BLASTX nr result
ID: Jatropha_contig00037928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037928 (328 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510210.1| DCL protein, chloroplast precursor, putative... 62 1e-07 >ref|XP_002510210.1| DCL protein, chloroplast precursor, putative [Ricinus communis] gi|223550911|gb|EEF52397.1| DCL protein, chloroplast precursor, putative [Ricinus communis] Length = 214 Score = 61.6 bits (148), Expect = 1e-07 Identities = 36/55 (65%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +2 Query: 170 MTMASLPEPYPPCLQSR-SNPISIYSFPMILSFRFHQ-TTSLSQPIRALKTGSDG 328 MTMASL +P PPCL SNPIS+Y P+ILSF FH+ TTS + I ALKTGSDG Sbjct: 1 MTMASLSKP-PPCLHGHYSNPISLYFSPVILSFPFHRTTTSFNSRIFALKTGSDG 54