BLASTX nr result
ID: Jatropha_contig00037783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037783 (691 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW07087.1| hypothetical protein PHAVU_010G100200g [Phaseolus... 85 2e-14 ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi... 85 2e-14 ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 85 2e-14 dbj|BAK02014.1| predicted protein [Hordeum vulgare subsp. vulgar... 84 4e-14 ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ri... 84 4e-14 ref|XP_003557690.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 84 5e-14 gb|AFK34026.1| unknown [Medicago truncatula] 83 7e-14 ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 83 9e-14 gb|EEE81865.2| ubiquitin carrier protein 4 [Populus trichocarpa] 83 9e-14 ref|XP_002320806.1| predicted protein [Populus trichocarpa] gi|2... 83 9e-14 ref|XP_002302592.1| predicted protein [Populus trichocarpa] gi|1... 83 9e-14 ref|XP_006358673.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 82 2e-13 gb|ERM94961.1| hypothetical protein AMTR_s00009p00214490 [Ambore... 82 2e-13 gb|EOX95923.1| Ubiquitin-conjugating enzyme E2 5 isoform 4 [Theo... 82 2e-13 gb|EOX95921.1| Ubiquitin-conjugating enzyme E2 5 isoform 2 [Theo... 82 2e-13 gb|EOX95920.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theo... 82 2e-13 ref|XP_004248050.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 82 2e-13 ref|XP_004229945.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 82 2e-13 ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 82 2e-13 ref|XP_003627554.1| Ubiquitin carrier protein [Medicago truncatu... 82 2e-13 >gb|ESW07087.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris] Length = 183 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi|6066285|gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max] Length = 183 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Glycine max] Length = 183 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >dbj|BAK02014.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326492562|dbj|BAK02064.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326511283|dbj|BAJ87655.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326512886|dbj|BAK03350.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 184 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKVD+IND MQEF+VHFHGPN+S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVDMINDGMQEFFVHFHGPNDS 42 >ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis] gi|223549063|gb|EEF50552.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis] Length = 183 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGPN+S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNDS 42 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 623 PYHGGVWRIRVELPDAYPYKSPS 691 PYHGGVWRIRVELPDAYPYKSPS Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPS 65 >ref|XP_003557690.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Brachypodium distachyon] Length = 186 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV+++ND MQEFYVHFHGPN+S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVHFHGPNDS 42 >gb|AFK34026.1| unknown [Medicago truncatula] Length = 185 Score = 83.2 bits (204), Expect = 7e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGP+ES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSES 42 >ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum tuberosum] Length = 184 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGP ES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTES 42 >gb|EEE81865.2| ubiquitin carrier protein 4 [Populus trichocarpa] Length = 183 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHF+GPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNES 42 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 623 PYHGGVWRIRVELPDAYPYKSPS 691 PYHGGVWRIRVELPDAYPYKSPS Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPS 65 >ref|XP_002320806.1| predicted protein [Populus trichocarpa] gi|222861579|gb|EEE99121.1| ubiquitin carrier protein 4 [Populus trichocarpa] Length = 183 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHF+GPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNES 42 >ref|XP_002302592.1| predicted protein [Populus trichocarpa] gi|118489895|gb|ABK96745.1| unknown [Populus trichocarpa x Populus deltoides] Length = 183 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHF+GPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNES 42 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 623 PYHGGVWRIRVELPDAYPYKSPS 691 PYHGGVWRIRVELPDAYPYKSPS Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPS 65 >ref|XP_006358673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum tuberosum] Length = 183 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGP ES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAES 42 >gb|ERM94961.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda] Length = 183 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRR+MDLMKLMMSDYKVD+IND MQEFYV FHGPNES Sbjct: 1 MSSPSKRRDMDLMKLMMSDYKVDMINDGMQEFYVDFHGPNES 42 >gb|EOX95923.1| Ubiquitin-conjugating enzyme E2 5 isoform 4 [Theobroma cacao] Length = 174 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHF GPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNES 42 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 623 PYHGGVWRIRVELPDAYPYKSPS 691 PYHGGVWRIRVELPDAYPYKSPS Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPS 65 >gb|EOX95921.1| Ubiquitin-conjugating enzyme E2 5 isoform 2 [Theobroma cacao] Length = 183 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHF GPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNES 42 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 623 PYHGGVWRIRVELPDAYPYKSPS 691 PYHGGVWRIRVELPDAYPYKSPS Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPS 65 >gb|EOX95920.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao] Length = 187 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHF GPNES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNES 42 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 623 PYHGGVWRIRVELPDAYPYKSPS 691 PYHGGVWRIRVELPDAYPYKSPS Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPS 65 >ref|XP_004248050.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Solanum lycopersicum] Length = 183 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGP ES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAES 42 >ref|XP_004229945.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Solanum lycopersicum] Length = 184 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGP ES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAES 42 >ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Vitis vinifera] gi|147789691|emb|CAN74060.1| hypothetical protein VITISV_024680 [Vitis vinifera] gi|297745317|emb|CBI40397.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNES 213 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGP++S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDS 42 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 623 PYHGGVWRIRVELPDAYPYKSPS 691 PYHGGVWRIRVELPDAYPYKSPS Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPS 65 >ref|XP_003627554.1| Ubiquitin carrier protein [Medicago truncatula] gi|355521576|gb|AET02030.1| Ubiquitin carrier protein [Medicago truncatula] Length = 191 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 88 MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNE 210 MSSPSKRREMDLMKLMMSDYKV++IND MQEFYVHFHGP+E Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSE 41