BLASTX nr result
ID: Jatropha_contig00037496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037496 (614 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002720150.1| rps3 [Jatropha curcas] gi|224979602|gb|ACN72... 95 2e-17 ref|YP_005090216.1| rps3 gene product (chloroplast) [Ricinus com... 89 9e-16 gb|AFU95831.1| Rps3, partial (chloroplast) [Euphorbia maculata] 88 2e-15 gb|ADX99143.1| ribosomal protein S3 [Rhaphithamnus venustus] 87 3e-15 gb|ADD29926.1| ribosomal protein S3 [Antirrhinum majus] 87 3e-15 gb|ADD29946.1| ribosomal protein S3 [Oxalis latifolia] 87 3e-15 ref|YP_008815976.1| ribosomal protein S3 (chloroplast) [Lindenbe... 86 6e-15 gb|AFV61851.1| ribosomal protein S3 (chloroplast) [Origanum vulg... 86 6e-15 gb|AGJ51288.1| ribosomal protein S3 (chloroplast) [Solanum carol... 86 6e-15 ref|YP_007507150.1| ribosomal protein S3 (chloroplast) [Salvia m... 86 6e-15 ref|YP_004935705.1| rps3 gene product (chloroplast) [Sesamum ind... 86 6e-15 gb|ADX99154.1| ribosomal protein S3 [Recordia boliviana] 86 6e-15 gb|ADX99149.1| ribosomal protein S3 [Tamonea boxiana] 86 6e-15 gb|ADX99141.1| ribosomal protein S3 [Lampayo castellani] 86 6e-15 gb|ADX99140.1| ribosomal protein S3 [Neosparton ephedroides] 86 6e-15 gb|ADX99139.1| ribosomal protein S3 [Dipyrena glaberrima] 86 6e-15 gb|ADX99138.1| ribosomal protein S3 [Mulguraea aspera] 86 6e-15 gb|ADX99137.1| ribosomal protein S3 [Junellia juniperina] 86 6e-15 gb|ADX99136.1| ribosomal protein S3 [Verbena officinalis] 86 6e-15 gb|ADX99135.1| ribosomal protein S3 [Aloysia citrodora] 86 6e-15 >ref|YP_002720150.1| rps3 [Jatropha curcas] gi|224979602|gb|ACN72729.1| rps3 [Jatropha curcas] Length = 221 Score = 94.7 bits (234), Expect = 2e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE Sbjct: 178 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 221 >ref|YP_005090216.1| rps3 gene product (chloroplast) [Ricinus communis] gi|339516204|gb|AEJ82594.1| ribosomal protein S3 [Ricinus communis] Length = 218 Score = 89.0 bits (219), Expect = 9e-16 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKK 130 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIWTFLDKK Sbjct: 176 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWTFLDKK 218 >gb|AFU95831.1| Rps3, partial (chloroplast) [Euphorbia maculata] Length = 268 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKK 130 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIWTF+DKK Sbjct: 226 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWTFIDKK 268 >gb|ADX99143.1| ribosomal protein S3 [Rhaphithamnus venustus] Length = 195 Score = 87.4 bits (215), Expect = 3e-15 Identities = 38/44 (86%), Positives = 44/44 (100%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEW+REGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIWTF+DK+E Sbjct: 151 VEWMREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWTFIDKEE 194 >gb|ADD29926.1| ribosomal protein S3 [Antirrhinum majus] Length = 220 Score = 87.4 bits (215), Expect = 3e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTIQAKI+YCSYTV+TIYGVLGIK+W F+DK+E Sbjct: 176 VEWIREGRVPLQTIQAKIDYCSYTVRTIYGVLGIKVWIFIDKEE 219 >gb|ADD29946.1| ribosomal protein S3 [Oxalis latifolia] Length = 223 Score = 87.0 bits (214), Expect = 3e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE*TFT 145 VEWIREGRVPLQTI+AKIEYCSYTV+TIYGVLGIKIW F+D+++ FT Sbjct: 176 VEWIREGRVPLQTIRAKIEYCSYTVRTIYGVLGIKIWIFIDEEKQAFT 223 >ref|YP_008815976.1| ribosomal protein S3 (chloroplast) [Lindenbergia philippensis] gi|557136903|emb|CDI43957.1| ribosomal protein S3 (chloroplast) [Lindenbergia philippensis] Length = 220 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 176 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 219 >gb|AFV61851.1| ribosomal protein S3 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 220 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 176 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 219 >gb|AGJ51288.1| ribosomal protein S3 (chloroplast) [Solanum carolinense] Length = 218 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKK 130 VEWIREGRVPLQTIQAKI+YCSYTV+TIYG+LGIKIW FLDK+ Sbjct: 176 VEWIREGRVPLQTIQAKIDYCSYTVRTIYGILGIKIWIFLDKE 218 >ref|YP_007507150.1| ribosomal protein S3 (chloroplast) [Salvia miltiorrhiza] gi|401879780|gb|AFQ30967.1| ribosomal protein S3 (chloroplast) [Salvia miltiorrhiza] Length = 220 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 176 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 219 >ref|YP_004935705.1| rps3 gene product (chloroplast) [Sesamum indicum] gi|347448334|gb|AEO92745.1| ribosomal protein S3 (chloroplast) [Sesamum indicum] gi|496538640|gb|AGL45375.1| ribosomal protein S3 (chloroplast) [Sesamum indicum] Length = 220 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 176 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 219 >gb|ADX99154.1| ribosomal protein S3 [Recordia boliviana] Length = 193 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 149 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 192 >gb|ADX99149.1| ribosomal protein S3 [Tamonea boxiana] Length = 196 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 152 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 195 >gb|ADX99141.1| ribosomal protein S3 [Lampayo castellani] Length = 195 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 151 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 194 >gb|ADX99140.1| ribosomal protein S3 [Neosparton ephedroides] Length = 195 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 151 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 194 >gb|ADX99139.1| ribosomal protein S3 [Dipyrena glaberrima] Length = 195 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 151 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 194 >gb|ADX99138.1| ribosomal protein S3 [Mulguraea aspera] Length = 195 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 151 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 194 >gb|ADX99137.1| ribosomal protein S3 [Junellia juniperina] Length = 195 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 151 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 194 >gb|ADX99136.1| ribosomal protein S3 [Verbena officinalis] Length = 193 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 149 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 192 >gb|ADX99135.1| ribosomal protein S3 [Aloysia citrodora] Length = 193 Score = 86.3 bits (212), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 VEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE 133 VEWIREGRVPLQTI+AKI+YCSYTV+TIYGVLGIKIW F+DK+E Sbjct: 149 VEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEE 192