BLASTX nr result
ID: Jatropha_contig00037290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037290 (386 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516148.1| conserved hypothetical protein [Ricinus comm... 46 6e-06 >ref|XP_002516148.1| conserved hypothetical protein [Ricinus communis] gi|223544634|gb|EEF46150.1| conserved hypothetical protein [Ricinus communis] Length = 224 Score = 45.8 bits (107), Expect(2) = 6e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 242 VQSAYKGKCDSTYALEEALPIRRGISEFYT 331 VQS YKGK D ALE+ALPIRRG+S+FY+ Sbjct: 53 VQSVYKGKIDLLDALEDALPIRRGVSKFYS 82 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +3 Query: 333 GRSKSFVCLAEASGFSSI 386 GRSKSF C+A AS +SSI Sbjct: 83 GRSKSFACVAGASSYSSI 100