BLASTX nr result
ID: Jatropha_contig00037283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037283 (563 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGJ52158.1| WRKY transcription factor 01.1 [Jatropha curcas] 72 9e-11 gb|AGJ52157.1| WRKY transcription factor 01.2 [Jatropha curcas] 72 9e-11 >gb|AGJ52158.1| WRKY transcription factor 01.1 [Jatropha curcas] Length = 476 Score = 72.0 bits (175), Expect = 9e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 458 MVSSGEDLDKFASDESEKRLHPDKSHTVHQIDGSG 562 MVSSGEDLDKFASDESEKRLHPDKSHTV QIDGSG Sbjct: 1 MVSSGEDLDKFASDESEKRLHPDKSHTVQQIDGSG 35 >gb|AGJ52157.1| WRKY transcription factor 01.2 [Jatropha curcas] Length = 276 Score = 72.0 bits (175), Expect = 9e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 458 MVSSGEDLDKFASDESEKRLHPDKSHTVHQIDGSG 562 MVSSGEDLDKFASDESEKRLHPDKSHTV QIDGSG Sbjct: 1 MVSSGEDLDKFASDESEKRLHPDKSHTVQQIDGSG 35