BLASTX nr result
ID: Jatropha_contig00037166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037166 (443 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN16302.1| hypothetical protein AMTR_s00063p00208440 [Ambore... 67 1e-19 gb|ERN04089.1| hypothetical protein AMTR_s05659p00000220 [Ambore... 45 2e-06 >gb|ERN16302.1| hypothetical protein AMTR_s00063p00208440 [Amborella trichopoda] Length = 107 Score = 67.4 bits (163), Expect(3) = 1e-19 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 193 PWGRGSPDFHRSLVRPPNEN*GPCAGVSSLRLA 95 PWGRGSPDFHRSLVRPPNEN GPC G+ SLRLA Sbjct: 23 PWGRGSPDFHRSLVRPPNENLGPCTGLLSLRLA 55 Score = 53.5 bits (127), Expect(3) = 1e-19 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -3 Query: 96 LALYGVPRGSSTSSASRREECHQLGRYWPLTT 1 LALYGVP G S SAS R ECHQLGRYWPLTT Sbjct: 54 LALYGVPHGFS--SASHRGECHQLGRYWPLTT 83 Score = 20.8 bits (42), Expect(3) = 1e-19 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 209 DTVALPMGTG*P 174 DT+ALP G G P Sbjct: 18 DTIALPWGRGSP 29 >gb|ERN04089.1| hypothetical protein AMTR_s05659p00000220 [Amborella trichopoda] Length = 102 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 29/58 (50%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +2 Query: 164 MEVGATPSPWATQQCPEGGVRGLIVART-FFLSISRSCEGGQSKIVLFLYKDNRRSQR 334 MEVGATPSPW RGLIVART FFL ++ KDNRRSQR Sbjct: 1 MEVGATPSPWQRNSVLREEFRGLIVARTSFFLGHAKG--ASPRSYCSSTKKDNRRSQR 56 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 337 RRHYLSGLFQLLHDFVP 387 RRH LS FQLLHDFVP Sbjct: 58 RRHSLSEFFQLLHDFVP 74