BLASTX nr result
ID: Jatropha_contig00037160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037160 (446 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519734.1| Calcium-activated outward-rectifying potassi... 81 2e-13 ref|XP_002317301.1| outward rectifying potassium channel [Populu... 79 8e-13 gb|ERP66461.1| calcium-activated outward-rectifying potassium ch... 76 5e-12 ref|XP_002331863.1| outward rectifying potassium channel [Populu... 76 5e-12 gb|ESR62873.1| hypothetical protein CICLE_v10015235mg [Citrus cl... 69 3e-10 gb|EOY27789.1| Ca2+ activated outward rectifying K+ channel 6 is... 68 1e-09 gb|EOY27788.1| Ca2+ activated outward rectifying K+ channel 6 is... 68 1e-09 ref|XP_003531079.1| PREDICTED: probable calcium-activated outwar... 67 2e-09 ref|XP_003524789.1| PREDICTED: LOW QUALITY PROTEIN: probable cal... 65 1e-08 ref|XP_004293667.1| PREDICTED: two-pore potassium channel 3-like... 64 1e-08 gb|ESW30965.1| hypothetical protein PHAVU_002G197400g [Phaseolus... 64 2e-08 ref|XP_004134597.1| PREDICTED: two-pore potassium channel 3-like... 64 3e-08 ref|NP_193550.1| calcium-activated outward-rectifying potassium ... 62 6e-08 ref|XP_002870067.1| hypothetical protein ARALYDRAFT_914875 [Arab... 62 6e-08 ref|XP_006283544.1| hypothetical protein CARUB_v10004597mg, part... 61 2e-07 gb|ABX60975.1| TPK1 [Nicotiana tabacum] 61 2e-07 ref|XP_004504709.1| PREDICTED: two-pore potassium channel 3-like... 60 3e-07 ref|XP_004504708.1| PREDICTED: two-pore potassium channel 3-like... 60 3e-07 emb|CBI30826.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_002272049.1| PREDICTED: probable calcium-activated outwar... 60 4e-07 >ref|XP_002519734.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223541151|gb|EEF42707.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 426 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/62 (62%), Positives = 48/62 (77%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+ +PLLP+ SPR++TPP L +L LPE DEVSLPL I+PS LKERLIFGP S SP D Sbjct: 1 MENDPLLPYHSPRKRTPPQLPPILCPLPEDDEVSLPLSISPSELKERLIFGP--SPSPND 58 Query: 411 TS 416 ++ Sbjct: 59 ST 60 >ref|XP_002317301.1| outward rectifying potassium channel [Populus trichocarpa] gi|222860366|gb|EEE97913.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] Length = 428 Score = 78.6 bits (192), Expect = 8e-13 Identities = 41/62 (66%), Positives = 49/62 (79%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+KEPLLP+ SPR++TP LL LPE DE+SLPLP+TPS LK+RLIFGP+ SSSP D Sbjct: 1 MEKEPLLPYVSPRKRTPQP-PPLLCPLPEDDEISLPLPLTPSELKDRLIFGPS-SSSPGD 58 Query: 411 TS 416 S Sbjct: 59 RS 60 >gb|ERP66461.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] Length = 433 Score = 75.9 bits (185), Expect = 5e-12 Identities = 39/62 (62%), Positives = 48/62 (77%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+KEPLLP+ SPR++ P L LPE DE+SLPLP+TPS LK+RLIFGP+ S+SPRD Sbjct: 1 MEKEPLLPYLSPRKRIPQPQPPLFP-LPEDDEISLPLPLTPSELKDRLIFGPS-SASPRD 58 Query: 411 TS 416 S Sbjct: 59 PS 60 >ref|XP_002331863.1| outward rectifying potassium channel [Populus trichocarpa] Length = 435 Score = 75.9 bits (185), Expect = 5e-12 Identities = 39/62 (62%), Positives = 48/62 (77%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+KEPLLP+ SPR++ P L LPE DE+SLPLP+TPS LK+RLIFGP+ S+SPRD Sbjct: 1 MEKEPLLPYLSPRKRIPQPQPPLFP-LPEDDEISLPLPLTPSELKDRLIFGPS-SASPRD 58 Query: 411 TS 416 S Sbjct: 59 PS 60 >gb|ESR62873.1| hypothetical protein CICLE_v10015235mg [Citrus clementina] Length = 447 Score = 69.3 bits (168), Expect(2) = 3e-10 Identities = 37/62 (59%), Positives = 45/62 (72%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+KEPLL + SPR+K P L L LPE E+S+P+PITPS LK+RLIFGP +SPRD Sbjct: 1 MEKEPLLCYLSPRKKPTPPLP--LFPLPEDGEISIPMPITPSELKDRLIFGPV--TSPRD 56 Query: 411 TS 416 S Sbjct: 57 AS 58 Score = 20.8 bits (42), Expect(2) = 3e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 418 PIVDALTLS 444 PIVDALTLS Sbjct: 59 PIVDALTLS 67 >gb|EOY27789.1| Ca2+ activated outward rectifying K+ channel 6 isoform 2, partial [Theobroma cacao] Length = 527 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = +3 Query: 225 FDMDKEPLLPFQSPRRK-TPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSS 401 F M+ +PLLP+ SP +K TPP L LPE+DEVS+PLP+TPS K+RLIFGP+ SSS Sbjct: 87 FHMENDPLLPYVSPIKKITPP---PPLFPLPENDEVSVPLPLTPSEFKDRLIFGPSPSSS 143 >gb|EOY27788.1| Ca2+ activated outward rectifying K+ channel 6 isoform 1 [Theobroma cacao] Length = 532 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = +3 Query: 225 FDMDKEPLLPFQSPRRK-TPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSS 401 F M+ +PLLP+ SP +K TPP L LPE+DEVS+PLP+TPS K+RLIFGP+ SSS Sbjct: 95 FHMENDPLLPYVSPIKKITPP---PPLFPLPENDEVSVPLPLTPSEFKDRLIFGPSPSSS 151 >ref|XP_003531079.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 6-like [Glycine max] Length = 430 Score = 67.0 bits (162), Expect = 2e-09 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSS-SPR 407 M+KEPLLP+ SPR+K P L LPEHDE+ LP+ TPS K+RLIFGP+ SS SPR Sbjct: 1 MEKEPLLPYFSPRKKPQPFPP--LCPLPEHDEIVLPM--TPSEFKDRLIFGPSPSSASPR 56 Query: 408 DTS 416 D S Sbjct: 57 DPS 59 >ref|XP_003524789.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-activated outward-rectifying potassium channel 6-like [Glycine max] Length = 426 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/63 (58%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSS-SPR 407 M+KEPLLP+ SPR+K L LPEHDE+ LP+ TPS K+RLIFGP+ SS SPR Sbjct: 1 MEKEPLLPYFSPRKKPQ------LCPLPEHDEIVLPM--TPSEFKDRLIFGPSPSSASPR 52 Query: 408 DTS 416 D S Sbjct: 53 DPS 55 >ref|XP_004293667.1| PREDICTED: two-pore potassium channel 3-like [Fragaria vesca subsp. vesca] Length = 433 Score = 64.3 bits (155), Expect = 1e-08 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 6/68 (8%) Frame = +3 Query: 231 MDKEPLLPF-QSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFG-----PAV 392 MDKEPLLP+ SPRRK P T L LPEHDEV P+P+TP K+R+IFG A Sbjct: 1 MDKEPLLPYTSSPRRKLPS--LTTLWPLPEHDEV--PVPLTPLEFKDRIIFGSPAAATAT 56 Query: 393 SSSPRDTS 416 SSSP D+S Sbjct: 57 SSSPHDSS 64 >gb|ESW30965.1| hypothetical protein PHAVU_002G197400g [Phaseolus vulgaris] Length = 389 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/62 (58%), Positives = 44/62 (70%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+KEPLLP+ SPR+K P + L LPEHDE + LP+TP K+RLIFGP V +SPRD Sbjct: 1 MEKEPLLPYFSPRKKPQP--LSPLCPLPEHDE--MVLPMTPMEFKDRLIFGP-VCASPRD 55 Query: 411 TS 416 S Sbjct: 56 PS 57 >ref|XP_004134597.1| PREDICTED: two-pore potassium channel 3-like [Cucumis sativus] gi|449505938|ref|XP_004162609.1| PREDICTED: two-pore potassium channel 3-like [Cucumis sativus] Length = 425 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/62 (56%), Positives = 45/62 (72%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+KEPLLP+ SPR K P + L LPE+DE++LP+ TP+ K+RLIFGP SSSP+D Sbjct: 1 MEKEPLLPYLSPRGKPSP-IPPQLCPLPENDEITLPM--TPTEFKDRLIFGP--SSSPQD 55 Query: 411 TS 416 S Sbjct: 56 AS 57 >ref|NP_193550.1| calcium-activated outward-rectifying potassium channel 6 [Arabidopsis thaliana] gi|38605078|sp|Q9SVV6.1|TPK3_ARATH RecName: Full=Two-pore potassium channel 3; Short=AtTPK3; AltName: Full=Calcium-activated outward-rectifying potassium channel 6; Short=AtKCO6 gi|5817002|emb|CAB53657.1| potassium channel-like protein [Arabidopsis thaliana] gi|7268609|emb|CAB78818.1| potassium channel-like protein [Arabidopsis thaliana] gi|332658605|gb|AEE84005.1| calcium-activated outward-rectifying potassium channel 6 [Arabidopsis thaliana] Length = 436 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/60 (58%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = +3 Query: 240 EPLLPFQ-SPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRDTS 416 +PLL + SPR K PP L L LPE +EV++P+P+TPS KERLIFGP S SPRD+S Sbjct: 7 DPLLQYMISPRLKKPPQL---LFPLPEDNEVAIPMPMTPSEFKERLIFGP-FSCSPRDSS 62 >ref|XP_002870067.1| hypothetical protein ARALYDRAFT_914875 [Arabidopsis lyrata subsp. lyrata] gi|297315903|gb|EFH46326.1| hypothetical protein ARALYDRAFT_914875 [Arabidopsis lyrata subsp. lyrata] Length = 438 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/60 (58%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = +3 Query: 240 EPLLPFQ-SPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRDTS 416 +PLL + SPR K PP L L LPE +EV++P+P+TPS KERLIFGP S SPRD+S Sbjct: 7 DPLLQYMISPRLKKPPQL---LFPLPEDNEVAIPMPMTPSEFKERLIFGP-FSRSPRDSS 62 >ref|XP_006283544.1| hypothetical protein CARUB_v10004597mg, partial [Capsella rubella] gi|482552249|gb|EOA16442.1| hypothetical protein CARUB_v10004597mg, partial [Capsella rubella] Length = 517 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/60 (56%), Positives = 44/60 (73%), Gaps = 1/60 (1%) Frame = +3 Query: 240 EPLLPFQ-SPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRDTS 416 +PLL + SPR K PP L L LPE +EV++P+P+TPS K+RLIFGP +S SPRD+S Sbjct: 86 DPLLQYIISPRLKRPPQL---LFPLPEDNEVAIPMPMTPSEFKDRLIFGP-LSRSPRDSS 141 >gb|ABX60975.1| TPK1 [Nicotiana tabacum] Length = 428 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 5/62 (8%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATL-----LSSLPEHDEVSLPLPITPSNLKERLIFGPAVS 395 M+KEPLLP+ S R TPPH + L LPE +E+S+P P+TPS LKERLIFG + + Sbjct: 1 MEKEPLLPYVSTR--TPPHPPSYPAPISLCPLPEDNEISIPPPLTPSELKERLIFGTSEA 58 Query: 396 SS 401 S+ Sbjct: 59 SA 60 >ref|XP_004504709.1| PREDICTED: two-pore potassium channel 3-like isoform X2 [Cicer arietinum] Length = 238 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/62 (56%), Positives = 44/62 (70%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+KEPLLP+ SPR+K P L + L LPE+DE + LP+TPS K+RLIFGP+ SP D Sbjct: 1 MEKEPLLPYFSPRKKLSP-LPSHLFPLPENDE--MVLPVTPSEFKDRLIFGPS-CVSPID 56 Query: 411 TS 416 S Sbjct: 57 PS 58 >ref|XP_004504708.1| PREDICTED: two-pore potassium channel 3-like isoform X1 [Cicer arietinum] Length = 428 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/62 (56%), Positives = 44/62 (70%) Frame = +3 Query: 231 MDKEPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRD 410 M+KEPLLP+ SPR+K P L + L LPE+DE + LP+TPS K+RLIFGP+ SP D Sbjct: 1 MEKEPLLPYFSPRKKLSP-LPSHLFPLPENDE--MVLPVTPSEFKDRLIFGPS-CVSPID 56 Query: 411 TS 416 S Sbjct: 57 PS 58 >emb|CBI30826.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/59 (59%), Positives = 42/59 (71%) Frame = +3 Query: 240 EPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRDTS 416 EPLLP+ SPR+ P + L LPE DEV+LPL TPS K+RLIFGP+ SSSP D+S Sbjct: 3 EPLLPYLSPRKSRP----SPLFPLPEEDEVALPL--TPSEFKDRLIFGPS-SSSPSDSS 54 >ref|XP_002272049.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 6-like [Vitis vinifera] Length = 509 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/59 (59%), Positives = 42/59 (71%) Frame = +3 Query: 240 EPLLPFQSPRRKTPPHLATLLSSLPEHDEVSLPLPITPSNLKERLIFGPAVSSSPRDTS 416 EPLLP+ SPR+ P + L LPE DEV+LPL TPS K+RLIFGP+ SSSP D+S Sbjct: 91 EPLLPYLSPRKSRP----SPLFPLPEEDEVALPL--TPSEFKDRLIFGPS-SSSPSDSS 142