BLASTX nr result
ID: Jatropha_contig00037153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037153 (363 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519093.1| lipid binding protein, putative [Ricinus com... 59 8e-07 >ref|XP_002519093.1| lipid binding protein, putative [Ricinus communis] gi|223541756|gb|EEF43304.1| lipid binding protein, putative [Ricinus communis] Length = 99 Score = 58.5 bits (140), Expect = 8e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 DNYPCLLTTYKIDPNQALQLPVKCSLVEESFHC 101 +NYP LL++YKIDPN A+QLPVKC LV ESFHC Sbjct: 67 NNYPWLLSSYKIDPNLAMQLPVKCKLVGESFHC 99