BLASTX nr result
ID: Jatropha_contig00037144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037144 (572 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299961.1| predicted protein [Populus trichocarpa] gi|2... 67 3e-09 ref|XP_002513190.1| chaperone protein DNAj, putative [Ricinus co... 65 1e-08 ref|XP_002313281.1| predicted protein [Populus trichocarpa] gi|2... 62 1e-07 >ref|XP_002299961.1| predicted protein [Populus trichocarpa] gi|222847219|gb|EEE84766.1| GAMETOPHYTIC FACTOR 2 family protein [Populus trichocarpa] Length = 445 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 2/61 (3%) Frame = +3 Query: 225 MVRSHGVKLVSWLATRCSSSSLFEDSANSVSKSLLNGNCRRFS--SGIRNPVKVIGNCSP 398 MVRSH +LV WLA S +L ++SANSV KS+LNG+ RR S +G+ NPV+ IGN SP Sbjct: 1 MVRSHSARLVGWLARPSLSLNLLQESANSVHKSVLNGSYRRLSTTTGVCNPVRFIGNYSP 60 Query: 399 K 401 K Sbjct: 61 K 61 >ref|XP_002513190.1| chaperone protein DNAj, putative [Ricinus communis] gi|223547688|gb|EEF49181.1| chaperone protein DNAj, putative [Ricinus communis] Length = 441 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/59 (59%), Positives = 39/59 (66%) Frame = +3 Query: 225 MVRSHGVKLVSWLATRCSSSSLFEDSANSVSKSLLNGNCRRFSSGIRNPVKVIGNCSPK 401 MVRSHGVKLV+WLA R SS S NSV K LNGNCR S+G PV ++ N SPK Sbjct: 1 MVRSHGVKLVAWLARRSPSSI----STNSVFKDPLNGNCRSLSTGFSKPVGIMRNYSPK 55 >ref|XP_002313281.1| predicted protein [Populus trichocarpa] gi|222849689|gb|EEE87236.1| GAMETOPHYTIC FACTOR 2 family protein [Populus trichocarpa] Length = 430 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = +3 Query: 225 MVRSHGVKLVSWLATRCSSSSLFEDSANSVSKSLLNGNCRRFS--SGIRNPVKVIGNCSP 398 MVRS GVKLV WLA R +L EDSA+SV KS+L+G+ RR S +G+ NPV+ GN + Sbjct: 1 MVRSRGVKLVGWLARRSLPFNLLEDSADSVYKSVLSGSFRRLSGAAGVYNPVRSFGNHTH 60 Query: 399 K 401 K Sbjct: 61 K 61