BLASTX nr result
ID: Jatropha_contig00037074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00037074 (654 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515328.1| nutrient reservoir, putative [Ricinus commun... 65 1e-08 >ref|XP_002515328.1| nutrient reservoir, putative [Ricinus communis] gi|223545808|gb|EEF47312.1| nutrient reservoir, putative [Ricinus communis] Length = 176 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +1 Query: 460 YEPPAGGEFYAPPGSGYGTNPTPYLPNYMPPQPSSATDYVHLKLMPMIIAVLVSFTALCC 639 Y PP G+FYAPPG GYG NP PY +Y PSSA + L L + A+ +S +LCC Sbjct: 116 YSPPGSGQFYAPPGPGYGNNPKPYFSDY---NPSSAFNSARLTLEMAVFAIFLSLISLCC 172