BLASTX nr result
ID: Jatropha_contig00036757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036757 (332 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524633.1| Cyclic nucleotide-gated ion channel, putativ... 65 1e-08 >ref|XP_002524633.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223536102|gb|EEF37758.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 778 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 227 MASYDKDEVPMLSDVQPRLFDENVDSRFQAFISRT 331 MASYDKDEVPMLSDV P+L DEN DSRFQAF+SRT Sbjct: 1 MASYDKDEVPMLSDVHPQLLDENPDSRFQAFVSRT 35