BLASTX nr result
ID: Jatropha_contig00036747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036747 (384 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative... 65 1e-08 gb|ERP66675.1| hypothetical protein POPTR_0001s39540g [Populus t... 57 2e-06 gb|ERP66674.1| hypothetical protein POPTR_0001s39540g [Populus t... 57 2e-06 gb|EMJ15089.1| hypothetical protein PRUPE_ppa006962mg [Prunus pe... 55 7e-06 >ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] gi|223536197|gb|EEF37850.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] Length = 388 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/43 (76%), Positives = 36/43 (83%), Gaps = 7/43 (16%) Frame = +2 Query: 275 DMWNYLWIPILISLSKELSLAKAA-------HSNILLPSQIDD 382 DMWNYLWIPILISLSKELSLAKA+ +SNILLPSQ+DD Sbjct: 40 DMWNYLWIPILISLSKELSLAKASRSNINSNNSNILLPSQLDD 82 >gb|ERP66675.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa] Length = 322 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 4/41 (9%) Frame = +2 Query: 272 PDMWNYLWIPILISLSKELSLAKAAHS----NILLPSQIDD 382 PDMWNYLWIP LISLSKEL+LA++A + +ILLPSQ+ D Sbjct: 39 PDMWNYLWIPFLISLSKELTLARSATATTSPSILLPSQLAD 79 >gb|ERP66674.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa] Length = 239 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 4/41 (9%) Frame = +2 Query: 272 PDMWNYLWIPILISLSKELSLAKAAHS----NILLPSQIDD 382 PDMWNYLWIP LISLSKEL+LA++A + +ILLPSQ+ D Sbjct: 39 PDMWNYLWIPFLISLSKELTLARSATATTSPSILLPSQLAD 79 >gb|EMJ15089.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica] Length = 388 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 275 DMWNYLWIPILISLSKELSLAKAAHSNILLPSQI 376 +MWNYLWIP LISLSKELSLAK A S ILLPSQ+ Sbjct: 39 EMWNYLWIPFLISLSKELSLAK-AQSPILLPSQL 71