BLASTX nr result
ID: Jatropha_contig00036585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036585 (439 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533992.1| conserved hypothetical protein [Ricinus comm... 69 5e-10 >ref|XP_002533992.1| conserved hypothetical protein [Ricinus communis] gi|223526012|gb|EEF28389.1| conserved hypothetical protein [Ricinus communis] Length = 269 Score = 69.3 bits (168), Expect = 5e-10 Identities = 38/81 (46%), Positives = 49/81 (60%), Gaps = 7/81 (8%) Frame = +2 Query: 170 MALQLYRFPLPXXXXXXXL------THFLFLY-NQPYYHLALRKRKLGNFCLHYHKSNNS 328 MALQ+Y+ P+ THFLFLY N + + +L +FCLH + SN S Sbjct: 1 MALQIYQLPVASPLSVSSSSSSSLHTHFLFLYHNHQQQFQSCSRIRLASFCLHQNTSNVS 60 Query: 329 WRRKKTGLLVGKEDLELRVQN 391 WR +K GLLVGKEDLE+RVQ+ Sbjct: 61 WRNRKNGLLVGKEDLEMRVQD 81