BLASTX nr result
ID: Jatropha_contig00036524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036524 (671 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301233.1| PREDICTED: uncharacterized protein LOC101312... 83 6e-14 gb|EMJ10692.1| hypothetical protein PRUPE_ppa010235mg [Prunus pe... 83 6e-14 ref|XP_002527685.1| conserved hypothetical protein [Ricinus comm... 83 6e-14 gb|ESR54572.1| hypothetical protein CICLE_v10020853mg [Citrus cl... 83 8e-14 gb|ESR54571.1| hypothetical protein CICLE_v10020853mg [Citrus cl... 83 8e-14 ref|XP_003634913.1| PREDICTED: uncharacterized protein LOC100243... 83 8e-14 ref|XP_002263023.2| PREDICTED: uncharacterized protein LOC100243... 83 8e-14 gb|ERN11064.1| hypothetical protein AMTR_s00024p00113120 [Ambore... 80 4e-13 gb|EPS63871.1| hypothetical protein M569_10911, partial [Genlise... 80 7e-13 gb|EOY21542.1| Uncharacterized protein isoform 2, partial [Theob... 80 7e-13 gb|EOY21541.1| Uncharacterized protein isoform 1 [Theobroma cacao] 80 7e-13 ref|XP_002329748.1| predicted protein [Populus trichocarpa] gi|5... 78 2e-12 ref|XP_004137519.1| PREDICTED: uncharacterized protein LOC101204... 78 3e-12 ref|XP_004956969.1| PREDICTED: uncharacterized protein LOC101777... 76 8e-12 ref|XP_006302464.1| hypothetical protein CARUB_v10020556mg [Caps... 74 3e-11 gb|AAO22674.1| unknown protein [Arabidopsis thaliana] 74 3e-11 ref|NP_849881.1| uncharacterized protein [Arabidopsis thaliana] ... 74 3e-11 ref|NP_001185391.1| uncharacterized protein [Arabidopsis thalian... 74 3e-11 ref|NP_565065.1| uncharacterized protein [Arabidopsis thaliana] ... 74 3e-11 gb|ESQ27838.1| hypothetical protein EUTSA_v10018766mg [Eutrema s... 74 5e-11 >ref|XP_004301233.1| PREDICTED: uncharacterized protein LOC101312837 [Fragaria vesca subsp. vesca] Length = 353 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRPSYRNVLLAVRK+LNI CS KLSTEDLEAEIFLHL++DYS Sbjct: 136 RGWRPSYRNVLLAVRKELNIPCSSKLSTEDLEAEIFLHLLRDYS 179 >gb|EMJ10692.1| hypothetical protein PRUPE_ppa010235mg [Prunus persica] Length = 258 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRPSYRNVLLAVRK+LNI CS KLSTEDLEAEIFLHL++DYS Sbjct: 41 RGWRPSYRNVLLAVRKELNIPCSSKLSTEDLEAEIFLHLLRDYS 84 >ref|XP_002527685.1| conserved hypothetical protein [Ricinus communis] gi|223532916|gb|EEF34684.1| conserved hypothetical protein [Ricinus communis] Length = 372 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDY 565 RGWRPSYRNVLLAVRKKLNI CSRKL TEDLEAEIFLHL+QD+ Sbjct: 155 RGWRPSYRNVLLAVRKKLNIPCSRKLPTEDLEAEIFLHLLQDH 197 >gb|ESR54572.1| hypothetical protein CICLE_v10020853mg [Citrus clementina] Length = 341 Score = 82.8 bits (203), Expect = 8e-14 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRYLSLVLAG 595 RGWRPSYRNVLLAVRK LNI CS KLSTEDLEAEIFLHL+Q+Y+ S V G Sbjct: 136 RGWRPSYRNVLLAVRKNLNIPCSSKLSTEDLEAEIFLHLLQEYASEESGVFPG 188 >gb|ESR54571.1| hypothetical protein CICLE_v10020853mg [Citrus clementina] Length = 354 Score = 82.8 bits (203), Expect = 8e-14 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRYLSLVLAG 595 RGWRPSYRNVLLAVRK LNI CS KLSTEDLEAEIFLHL+Q+Y+ S V G Sbjct: 136 RGWRPSYRNVLLAVRKNLNIPCSSKLSTEDLEAEIFLHLLQEYASEESGVFPG 188 >ref|XP_003634913.1| PREDICTED: uncharacterized protein LOC100243690 isoform 2 [Vitis vinifera] Length = 346 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRPSYRNVLL VRKKLN+ CS KLSTEDLE EIFLHL+QDYS Sbjct: 131 RGWRPSYRNVLLGVRKKLNVPCSSKLSTEDLEVEIFLHLLQDYS 174 >ref|XP_002263023.2| PREDICTED: uncharacterized protein LOC100243690 isoform 1 [Vitis vinifera] gi|296088813|emb|CBI38263.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRPSYRNVLL VRKKLN+ CS KLSTEDLE EIFLHL+QDYS Sbjct: 131 RGWRPSYRNVLLGVRKKLNVPCSSKLSTEDLEVEIFLHLLQDYS 174 >gb|ERN11064.1| hypothetical protein AMTR_s00024p00113120 [Amborella trichopoda] Length = 366 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDY 565 RGWRPSYRNVLL VR+KLN+ CS KLSTEDLEAEIFLHL+Q+Y Sbjct: 140 RGWRPSYRNVLLGVRRKLNVPCSNKLSTEDLEAEIFLHLLQEY 182 >gb|EPS63871.1| hypothetical protein M569_10911, partial [Genlisea aurea] Length = 258 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRPSYRNVLL VRKKLN+ CS KLS EDLEAEIFLHL+++YS Sbjct: 94 RGWRPSYRNVLLGVRKKLNVQCSAKLSVEDLEAEIFLHLLREYS 137 >gb|EOY21542.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] Length = 239 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRPSY+ VLL+VRKKLN+ CS KLSTEDLEAEIFLHL++DYS Sbjct: 130 RGWRPSYKTVLLSVRKKLNVPCSSKLSTEDLEAEIFLHLLRDYS 173 >gb|EOY21541.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 348 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRPSY+ VLL+VRKKLN+ CS KLSTEDLEAEIFLHL++DYS Sbjct: 130 RGWRPSYKTVLLSVRKKLNVPCSSKLSTEDLEAEIFLHLLRDYS 173 >ref|XP_002329748.1| predicted protein [Populus trichocarpa] gi|550321979|gb|ERP52019.1| hypothetical protein POPTR_0015s05170g [Populus trichocarpa] Length = 355 Score = 78.2 bits (191), Expect = 2e-12 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRP+YRNVLL VRKKL+I CS KLSTEDLEAEIFLHL+++Y+ Sbjct: 137 RGWRPTYRNVLLTVRKKLSIGCSSKLSTEDLEAEIFLHLLEEYA 180 >ref|XP_004137519.1| PREDICTED: uncharacterized protein LOC101204111 [Cucumis sativus] gi|449517717|ref|XP_004165891.1| PREDICTED: uncharacterized protein LOC101226231 [Cucumis sativus] Length = 343 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYS 568 RGWRPSYR+VLL VRKKLN+ CS KLS+EDLEAEIFLHL+Q+Y+ Sbjct: 130 RGWRPSYRDVLLTVRKKLNVLCSTKLSSEDLEAEIFLHLLQEYA 173 >ref|XP_004956969.1| PREDICTED: uncharacterized protein LOC101777100 [Setaria italica] Length = 384 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRY 574 RGWRPSYR+VLL VRKKL + CS KLST DLEAEIFLHLV +YS + Sbjct: 168 RGWRPSYRDVLLGVRKKLGVQCSSKLSTADLEAEIFLHLVNEYSSH 213 >ref|XP_006302464.1| hypothetical protein CARUB_v10020556mg [Capsella rubella] gi|482571174|gb|EOA35362.1| hypothetical protein CARUB_v10020556mg [Capsella rubella] Length = 352 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRYLSLVLAG 595 RGWRPSYRNVLLAVR LNI CS +L TEDLEAEIFL+LV ++S S V G Sbjct: 136 RGWRPSYRNVLLAVRNNLNIPCSSQLPTEDLEAEIFLYLVDNFSSEASGVFPG 188 >gb|AAO22674.1| unknown protein [Arabidopsis thaliana] Length = 350 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRYLSLVLAG 595 RGWRPSYRNVLLAVR LNI CS +L TEDLEAEIFL+LV ++S S V G Sbjct: 134 RGWRPSYRNVLLAVRNNLNIPCSSQLPTEDLEAEIFLYLVDNFSSEASGVFPG 186 >ref|NP_849881.1| uncharacterized protein [Arabidopsis thaliana] gi|182623788|gb|ACB88831.1| At1g73470 [Arabidopsis thaliana] gi|332197344|gb|AEE35465.1| uncharacterized protein AT1G73470 [Arabidopsis thaliana] Length = 248 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRYLSLVLAG 595 RGWRPSYRNVLLAVR LNI CS +L TEDLEAEIFL+LV ++S S V G Sbjct: 32 RGWRPSYRNVLLAVRNNLNIPCSSQLPTEDLEAEIFLYLVDNFSSEASGVFPG 84 >ref|NP_001185391.1| uncharacterized protein [Arabidopsis thaliana] gi|332197345|gb|AEE35466.1| uncharacterized protein AT1G73470 [Arabidopsis thaliana] Length = 357 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRYLSLVLAG 595 RGWRPSYRNVLLAVR LNI CS +L TEDLEAEIFL+LV ++S S V G Sbjct: 135 RGWRPSYRNVLLAVRNNLNIPCSSQLPTEDLEAEIFLYLVDNFSSEASGVFPG 187 >ref|NP_565065.1| uncharacterized protein [Arabidopsis thaliana] gi|21593462|gb|AAM65429.1| unknown [Arabidopsis thaliana] gi|124301178|gb|ABN04841.1| At1g73470 [Arabidopsis thaliana] gi|332197343|gb|AEE35464.1| uncharacterized protein AT1G73470 [Arabidopsis thaliana] Length = 351 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRYLSLVLAG 595 RGWRPSYRNVLLAVR LNI CS +L TEDLEAEIFL+LV ++S S V G Sbjct: 135 RGWRPSYRNVLLAVRNNLNIPCSSQLPTEDLEAEIFLYLVDNFSSEASGVFPG 187 >gb|ESQ27838.1| hypothetical protein EUTSA_v10018766mg [Eutrema salsugineum] gi|557086987|gb|ESQ27839.1| hypothetical protein EUTSA_v10018766mg [Eutrema salsugineum] gi|557086988|gb|ESQ27840.1| hypothetical protein EUTSA_v10018766mg [Eutrema salsugineum] Length = 357 Score = 73.6 bits (179), Expect = 5e-11 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = +2 Query: 437 RGWRPSYRNVLLAVRKKLNISCSRKLSTEDLEAEIFLHLVQDYSRYLSLVLAG 595 RGWRPSYRNVLLAVR KL+I CS +L TEDLEAEIFL+LV ++S S + G Sbjct: 141 RGWRPSYRNVLLAVRDKLSIPCSSQLPTEDLEAEIFLYLVDNFSSEASGIFPG 193