BLASTX nr result
ID: Jatropha_contig00036380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036380 (418 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518570.1| kinesin, putative [Ricinus communis] gi|2235... 59 1e-10 >ref|XP_002518570.1| kinesin, putative [Ricinus communis] gi|223542415|gb|EEF43957.1| kinesin, putative [Ricinus communis] Length = 798 Score = 59.3 bits (142), Expect(2) = 1e-10 Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 5/57 (8%) Frame = +2 Query: 182 IMASRNQYRPPRSPSTKD-----GGGGVPLDKXXXXXXXXXXXPNSTDRRPFGSVKK 337 +M+SRNQ RPPRSPSTKD GGGGVPLDK +TDR+PFGSV K Sbjct: 2 MMSSRNQNRPPRSPSTKDGGGAGGGGGVPLDKRRRIGAGRI---GATDRKPFGSVNK 55 Score = 32.0 bits (71), Expect(2) = 1e-10 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +1 Query: 334 KRQDGTAL--GDIGSTEGSECENNRFPKKK 417 KRQD TA D GSTE SECE+ F K++ Sbjct: 55 KRQDVTAAPGSDTGSTEASECESIEFSKEE 84