BLASTX nr result
ID: Jatropha_contig00036276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036276 (282 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524597.1| conserved hypothetical protein [Ricinus comm... 55 9e-06 >ref|XP_002524597.1| conserved hypothetical protein [Ricinus communis] gi|223536150|gb|EEF37805.1| conserved hypothetical protein [Ricinus communis] Length = 1277 Score = 55.1 bits (131), Expect = 9e-06 Identities = 28/65 (43%), Positives = 40/65 (61%) Frame = +1 Query: 85 ISEEPLYERHDSESPQKKLHDVSNGENVQSLAGKEILSPNSNSSGPGDTDSHLDLQVSQS 264 +++ P+ + +K L +VSN +NVQSLAGK S NS S+GP DS L+ +S + Sbjct: 806 MTQSPIKQELMGSPSRKDLFEVSNDDNVQSLAGKSTSSTNSTSNGPAHGDSRLEFHISNT 865 Query: 265 QIPAQ 279 QI AQ Sbjct: 866 QIFAQ 870