BLASTX nr result
ID: Jatropha_contig00036193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036193 (349 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus ... 46 4e-07 >ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223539404|gb|EEF40994.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 387 Score = 46.2 bits (108), Expect(2) = 4e-07 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = +1 Query: 166 MSSHEXXXXXXXXXXXXXFDGAILGVALAYAAVRSFLKFTSNSKA 300 MSSHE FDGA LGV +A AVRS LKF SNSKA Sbjct: 1 MSSHEQALASLVSQLALSFDGAFLGVVVALTAVRSILKFASNSKA 45 Score = 33.1 bits (74), Expect(2) = 4e-07 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 296 KPLRKIRSAPTVKVSDLR 349 K LRKIR+APTVKVSD+R Sbjct: 44 KALRKIRNAPTVKVSDIR 61