BLASTX nr result
ID: Jatropha_contig00036101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036101 (446 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523146.1| nucleic acid binding protein, putative [Rici... 76 5e-12 >ref|XP_002523146.1| nucleic acid binding protein, putative [Ricinus communis] gi|223537553|gb|EEF39177.1| nucleic acid binding protein, putative [Ricinus communis] Length = 700 Score = 75.9 bits (185), Expect = 5e-12 Identities = 52/120 (43%), Positives = 64/120 (53%), Gaps = 4/120 (3%) Frame = +2 Query: 65 MLRFAHCNPQTHLRKLIFLPSSINLLHMGSKFFFKPATXXXXXXXXXXXXT--RNPYHTF 238 M R+A+ +PQ HL KL S + MGSK F KP T + R YHT Sbjct: 1 MFRYAYYSPQIHLYKLSSSSSKVGF--MGSKLFLKPTTTTLPPLSPFSYSSSGRLQYHTC 58 Query: 239 KRLLPVACSKPISKIPPY--KANGFTSQATVPTPVYGEEEDLQTFEIWKLLKGKLGRVGV 412 +RLLPV CSKPISK PY K NGF AT+P PV E+ + E L+GKL +G+ Sbjct: 59 RRLLPVFCSKPISKNRPYLPKTNGF---ATLPAPVSSEDSEKPHLE---KLRGKLEVLGI 112