BLASTX nr result
ID: Jatropha_contig00036095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00036095 (427 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ11489.1| hypothetical protein PRUPE_ppa002664mg [Prunus pe... 60 3e-07 >gb|EMJ11489.1| hypothetical protein PRUPE_ppa002664mg [Prunus persica] Length = 647 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/59 (55%), Positives = 38/59 (64%) Frame = +1 Query: 139 MGESRVGTNMWKSIYKRNSIMELKSPESDMSFFIFGCRFWFRSAFNSYSVACEAFSEQQ 315 M ESR+G MW S+ RNS E + DM F GCRF RSA +SYSVACEAFSE + Sbjct: 1 MAESRIGLTMWSSVANRNSGTEFR----DMWFI--GCRFRLRSAVDSYSVACEAFSEHR 53