BLASTX nr result
ID: Jatropha_contig00035898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00035898 (537 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298222.1| predicted protein [Populus trichocarpa] 68 1e-09 ref|XP_002516024.1| 30S ribosomal protein S17, putative [Ricinus... 58 1e-06 >ref|XP_002298222.1| predicted protein [Populus trichocarpa] Length = 160 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +1 Query: 85 PFLHGTTPISHLSKPTSVFSLQPQKPFTSVPPIRAMRSMQASGFVAT 225 PFLHGTT +SHLSKPTS +L+P KPFT +PPIRAM+S+Q AT Sbjct: 19 PFLHGTTQLSHLSKPTSSLTLRPAKPFTFLPPIRAMKSLQGKVVCAT 65 >ref|XP_002516024.1| 30S ribosomal protein S17, putative [Ricinus communis] gi|223544929|gb|EEF46444.1| 30S ribosomal protein S17, putative [Ricinus communis] Length = 152 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +1 Query: 85 PFLHGTTPISHLSKPTSVFSLQPQKPFTSVPPIRAMRSMQASGFVAT 225 PFL+GT P+S+LSKPTS SLQ PF+ +PP+RAM+S+Q AT Sbjct: 15 PFLNGTAPLSNLSKPTSSLSLQHPNPFSFMPPVRAMKSIQGRVVCAT 61