BLASTX nr result
ID: Jatropha_contig00035877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00035877 (408 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521449.1| conserved hypothetical protein [Ricinus comm... 76 5e-12 >ref|XP_002521449.1| conserved hypothetical protein [Ricinus communis] gi|223539348|gb|EEF40939.1| conserved hypothetical protein [Ricinus communis] Length = 686 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +1 Query: 292 LEILG*AVTCKEMDGDSFCGEEDNFDWDSEDEREIENFG 408 LEILG AV KEMDGDSFCGE DNFDWDSEDEREIENFG Sbjct: 25 LEILGIAVASKEMDGDSFCGEGDNFDWDSEDEREIENFG 63