BLASTX nr result
ID: Jatropha_contig00035683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00035683 (561 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY10322.1| Uncharacterized protein TCM_025694 [Theobroma cacao] 57 4e-06 gb|EOY10326.1| Uncharacterized protein TCM_025700 [Theobroma cacao] 56 5e-06 gb|EOY10323.1| Uncharacterized protein TCM_025695 [Theobroma cacao] 56 7e-06 >gb|EOY10322.1| Uncharacterized protein TCM_025694 [Theobroma cacao] Length = 73 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 79 GN*VSAQPV-RVCTIPYGLPNCNDALCKANCVKLHGNAANGICLNSQQTCECFFPC 243 GN V AQ +VC +P+GLPNC DA C ++C + NG+C TC CF PC Sbjct: 19 GNEVKAQDQGKVCVVPFGLPNCKDATCNSSCQRKFPPKGNGMC-QGGATCLCFHPC 73 >gb|EOY10326.1| Uncharacterized protein TCM_025700 [Theobroma cacao] Length = 73 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = +1 Query: 106 RVCTIPYGLPNCNDALCKANCVKLHGNAANGICLNSQQTCECFFPC 243 +VC +P+GLPNC DA CK++C + NG+C TC CF PC Sbjct: 29 KVCAVPFGLPNCKDATCKSSCQRKFPPKGNGMC-QGGATCLCFHPC 73 >gb|EOY10323.1| Uncharacterized protein TCM_025695 [Theobroma cacao] Length = 159 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 79 GN*VSAQPV-RVCTIPYGLPNCNDALCKANCVKLHGNAANGICLNSQQTCECFFPC 243 GN V AQ +VC +P+GLPNC DA C ++C + NG+C TC CF PC Sbjct: 105 GNEVKAQDQGKVCAVPFGLPNCKDATCNSSCQRKFPPNGNGMC-QGGVTCLCFHPC 159