BLASTX nr result
ID: Jatropha_contig00035639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00035639 (302 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB85100.1| proteinase inhibitor [Jatropha curcas] 55 9e-06 >gb|ADB85100.1| proteinase inhibitor [Jatropha curcas] Length = 70 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +3 Query: 18 PGKSSWPEXXXXXXXXXXXXIEKENSNVNAIVLNEMSPVTPDFRC 152 PGKSSWPE IEKEN +VNAIVL E +PVT DFRC Sbjct: 6 PGKSSWPELLGANGKAAAALIEKENRHVNAIVLKEGTPVTRDFRC 50