BLASTX nr result
ID: Jatropha_contig00035005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00035005 (232 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519987.1| mta/sah nucleosidase, putative [Ricinus comm... 57 2e-06 >ref|XP_002519987.1| mta/sah nucleosidase, putative [Ricinus communis] gi|223540751|gb|EEF42311.1| mta/sah nucleosidase, putative [Ricinus communis] Length = 309 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/45 (71%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = +1 Query: 1 LPFIVFRGVANSAGASD--QSNGTLANENGVKAVNRFIFLATVPR 129 L FIVFRGV+N AGA D QS LAN N VKAV RFI+LATVPR Sbjct: 262 LDFIVFRGVSNYAGAGDSAQSASELANANAVKAVTRFIWLATVPR 306