BLASTX nr result
ID: Jatropha_contig00034743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00034743 (191 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362751.1| PREDICTED: COP9 signalosome complex subunit ... 60 2e-07 gb|EOY33022.1| Proteasome family protein isoform 2 [Theobroma ca... 60 2e-07 gb|EOY33021.1| Proteasome family protein isoform 1 [Theobroma ca... 60 2e-07 ref|XP_004228496.1| PREDICTED: COP9 signalosome complex subunit ... 60 2e-07 ref|XP_002532580.1| cop9 signalosome complex subunit, putative [... 60 3e-07 ref|XP_002330981.1| predicted protein [Populus trichocarpa] gi|5... 59 6e-07 ref|XP_004250886.1| PREDICTED: COP9 signalosome complex subunit ... 58 1e-06 gb|ESW33831.1| hypothetical protein PHAVU_001G102200g [Phaseolus... 58 1e-06 gb|ESR59651.1| hypothetical protein CICLE_v10015276mg [Citrus cl... 58 1e-06 gb|AGV54246.1| COP9 signalosome complex subunit 2-like protein [... 58 1e-06 ref|XP_004171136.1| PREDICTED: COP9 signalosome complex subunit ... 58 1e-06 ref|XP_004142257.1| PREDICTED: COP9 signalosome complex subunit ... 58 1e-06 dbj|BAD26577.1| CSN complex subunit 2 [Citrullus lanatus] 58 1e-06 ref|XP_004493278.1| PREDICTED: COP9 signalosome complex subunit ... 57 2e-06 gb|AFK46802.1| unknown [Lotus japonicus] 57 2e-06 gb|AFK43375.1| unknown [Lotus japonicus] 57 2e-06 ref|XP_003554075.1| PREDICTED: COP9 signalosome complex subunit ... 57 2e-06 ref|XP_003553843.1| PREDICTED: COP9 signalosome complex subunit ... 57 2e-06 ref|XP_003520479.1| PREDICTED: COP9 signalosome complex subunit ... 57 2e-06 ref|XP_003524609.1| PREDICTED: COP9 signalosome complex subunit ... 57 2e-06 >ref|XP_006362751.1| PREDICTED: COP9 signalosome complex subunit 2-like [Solanum tuberosum] Length = 439 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT IDKWNTQLRSLYQTVGN+V Sbjct: 410 RSKGMKKYTAIDKWNTQLRSLYQTVGNKV 438 >gb|EOY33022.1| Proteasome family protein isoform 2 [Theobroma cacao] Length = 437 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRVF 91 RSKGMKKYT IDKWNTQLRSLYQTV NRV+ Sbjct: 408 RSKGMKKYTAIDKWNTQLRSLYQTVSNRVY 437 >gb|EOY33021.1| Proteasome family protein isoform 1 [Theobroma cacao] Length = 439 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRVF 91 RSKGMKKYT IDKWNTQLRSLYQTV NRV+ Sbjct: 410 RSKGMKKYTAIDKWNTQLRSLYQTVSNRVY 439 >ref|XP_004228496.1| PREDICTED: COP9 signalosome complex subunit 2-like [Solanum lycopersicum] Length = 439 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT IDKWNTQLRSLYQTVGN+V Sbjct: 410 RSKGMKKYTAIDKWNTQLRSLYQTVGNKV 438 >ref|XP_002532580.1| cop9 signalosome complex subunit, putative [Ricinus communis] gi|223527689|gb|EEF29797.1| cop9 signalosome complex subunit, putative [Ricinus communis] Length = 439 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRVF 91 RSKGMKKYT IDKWNTQLRSLYQT+ NRV+ Sbjct: 410 RSKGMKKYTAIDKWNTQLRSLYQTISNRVY 439 >ref|XP_002330981.1| predicted protein [Populus trichocarpa] gi|550347952|gb|ERP65988.1| constitutive photomorphogenic 12 family protein [Populus trichocarpa] Length = 439 Score = 58.9 bits (141), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRVF 91 RSKGMKKYT I+KWNTQLRSLYQTV NRV+ Sbjct: 410 RSKGMKKYTAIEKWNTQLRSLYQTVSNRVY 439 >ref|XP_004250886.1| PREDICTED: COP9 signalosome complex subunit 2-like [Solanum lycopersicum] Length = 439 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKY IDKWNTQLRSLY+TVGNRV Sbjct: 410 RSKGMKKYAAIDKWNTQLRSLYRTVGNRV 438 >gb|ESW33831.1| hypothetical protein PHAVU_001G102200g [Phaseolus vulgaris] Length = 439 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT IDKWNTQL+SLYQT+ NRV Sbjct: 410 RSKGMKKYTAIDKWNTQLKSLYQTISNRV 438 >gb|ESR59651.1| hypothetical protein CICLE_v10015276mg [Citrus clementina] Length = 439 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT IDKWN+QLRSLYQTV NRV Sbjct: 410 RSKGMKKYTAIDKWNSQLRSLYQTVSNRV 438 >gb|AGV54246.1| COP9 signalosome complex subunit 2-like protein [Phaseolus vulgaris] Length = 439 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT IDKWNTQL+SLYQT+ NRV Sbjct: 410 RSKGMKKYTAIDKWNTQLKSLYQTISNRV 438 >ref|XP_004171136.1| PREDICTED: COP9 signalosome complex subunit 2-like [Cucumis sativus] Length = 231 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRVF 91 RSKGMKKYT IDKWNTQL+SL+QTV NRV+ Sbjct: 202 RSKGMKKYTAIDKWNTQLKSLFQTVSNRVY 231 >ref|XP_004142257.1| PREDICTED: COP9 signalosome complex subunit 2-like [Cucumis sativus] Length = 393 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRVF 91 RSKGMKKYT IDKWNTQL+SL+QTV NRV+ Sbjct: 364 RSKGMKKYTAIDKWNTQLKSLFQTVSNRVY 393 >dbj|BAD26577.1| CSN complex subunit 2 [Citrullus lanatus] Length = 48 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRVF 91 RSKGMKKYT IDKWNTQL+SL+QTV NRV+ Sbjct: 19 RSKGMKKYTAIDKWNTQLKSLFQTVSNRVY 48 >ref|XP_004493278.1| PREDICTED: COP9 signalosome complex subunit 2-like [Cicer arietinum] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT +DKWNTQL+SLYQT+ NRV Sbjct: 410 RSKGMKKYTAVDKWNTQLKSLYQTINNRV 438 >gb|AFK46802.1| unknown [Lotus japonicus] Length = 240 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT +DKWNTQL+SLYQT+ NRV Sbjct: 211 RSKGMKKYTAVDKWNTQLKSLYQTISNRV 239 >gb|AFK43375.1| unknown [Lotus japonicus] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT +DKWNTQL+SLYQT+ NRV Sbjct: 410 RSKGMKKYTAVDKWNTQLKSLYQTISNRV 438 >ref|XP_003554075.1| PREDICTED: COP9 signalosome complex subunit 2-like [Glycine max] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT +DKWNTQL+SLYQT+ NRV Sbjct: 410 RSKGMKKYTAVDKWNTQLKSLYQTISNRV 438 >ref|XP_003553843.1| PREDICTED: COP9 signalosome complex subunit 2-like [Glycine max] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT +DKWNTQL+SLYQT+ NRV Sbjct: 410 RSKGMKKYTAVDKWNTQLKSLYQTINNRV 438 >ref|XP_003520479.1| PREDICTED: COP9 signalosome complex subunit 2-like [Glycine max] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT +DKWNTQL+SLYQT+ NRV Sbjct: 410 RSKGMKKYTAVDKWNTQLKSLYQTISNRV 438 >ref|XP_003524609.1| PREDICTED: COP9 signalosome complex subunit 2-like [Glycine max] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 RSKGMKKYTGIDKWNTQLRSLYQTVGNRV 88 RSKGMKKYT +DKWNTQL+SLYQT+ NRV Sbjct: 410 RSKGMKKYTAVDKWNTQLKSLYQTINNRV 438