BLASTX nr result
ID: Jatropha_contig00034724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00034724 (615 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513069.1| electron transporter, putative [Ricinus comm... 65 1e-08 >ref|XP_002513069.1| electron transporter, putative [Ricinus communis] gi|223548080|gb|EEF49572.1| electron transporter, putative [Ricinus communis] Length = 274 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +2 Query: 482 MADFENNKEFAGKSKTSTIASSFFNRSLTIHSTKSSAIDYLHSP 613 MA+ E+N EF GKSK ST+ASS FNRSLTIHSTKSS DY+ SP Sbjct: 1 MAELESNMEFNGKSKPSTMASSLFNRSLTIHSTKSSPKDYVQSP 44