BLASTX nr result
ID: Jatropha_contig00034586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00034586 (644 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523463.1| conserved hypothetical protein [Ricinus comm... 69 1e-09 ref|XP_002329163.1| predicted protein [Populus trichocarpa] gi|5... 57 4e-06 >ref|XP_002523463.1| conserved hypothetical protein [Ricinus communis] gi|223537291|gb|EEF38922.1| conserved hypothetical protein [Ricinus communis] Length = 484 Score = 68.6 bits (166), Expect = 1e-09 Identities = 32/60 (53%), Positives = 44/60 (73%) Frame = +1 Query: 463 ISTSSEKNLQHCELSKSLDKNLLKEIGSVYSDENFCTVSAETGVYDYEVLGREGNINHPF 642 +STS+E+N+ C+ S S++KNL +IGSV SDE+ CT S ETG + +LG EGN+NH F Sbjct: 1 MSTSNEENVGFCQPSDSMEKNLFNDIGSVTSDESLCTESTETGSSNDGLLGSEGNVNHAF 60 >ref|XP_002329163.1| predicted protein [Populus trichocarpa] gi|550317140|gb|ERP49181.1| hypothetical protein POPTR_0019s09690g [Populus trichocarpa] Length = 587 Score = 57.0 bits (136), Expect = 4e-06 Identities = 39/107 (36%), Positives = 50/107 (46%) Frame = +1 Query: 322 KAISGRTYMCKVSIXXXXXXXXXXXXXXXXXXRGDGYSDEPVAVPVGISTSSEKNLQHCE 501 K I G+ KVS+ GDGY+D +PV IST +E + + Sbjct: 16 KDIRGKNQFYKVSLSLVFVLWGLVFLLSIWISHGDGYTDGSGDLPVSISTWNEATAEPSK 75 Query: 502 LSKSLDKNLLKEIGSVYSDENFCTVSAETGVYDYEVLGREGNINHPF 642 S S+ KN KE V SDE+ CT SAET + +L EGN N F Sbjct: 76 CSVSVHKNQSKETCPVCSDESSCTDSAETRGSNDTLLISEGNTNDAF 122